SimulationCraft 902-01

for World of Warcraft 9.0.2.36532 Live (wow build level 36532)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Nov 10 Restoration Druid Damage Aura (Periodic)
Restoration Druid (effect#6) base_value 25.00 31.00
Nov 10 Restoration Druid Damage Aura (Direct)
Restoration Druid (effect#5) base_value 25.00 31.00
Nov 10 Feral Druid Aura (Periodic)
Feral Druid (effect#2) base_value 29.00 20.00
Nov 10 Feral Druid Aura (Direct)
Feral Druid (effect#1) base_value 29.00 20.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-11-10 Freezing Rain hotfix
Freezing Rain (effect#2) base_value 60.00 50.00
2020-11-10 Ice Lance hotfix
Ice Lance (effect#1) sp_coefficient 0.38 0.42
2020-11-10 Comet Storm hotfix
Comet Storm (effect#1) sp_coefficient 0.42 0.40
2020-11-10 Arcane Explosion hotfix
Arcane Explosion (effect#2) sp_coefficient 0.50 0.55
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Forgelite : 11014 dps, 4893 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11013.7 11013.7 17.3 / 0.157% 1183.3 / 10.7% 5.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
1994.9 1895.3 Mana 0.00% 49.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Forgelite 11014
Arcane Barrage 3966 36.1% 55.5 5.42sec 21521 17267 Direct 166.3 6035 11983 7184 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.50 166.28 0.00 0.00 1.2464 0.0000 1194310.84 1194310.84 0.00% 17267.06 17267.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 134.16 100 172 6035.44 2082 30168 6021.34 5299 6648 809347 809347 0.00%
crit 19.32% 32.12 15 59 11982.64 4164 60336 11956.02 7382 17066 384964 384964 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.50
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 372 3.4% 59.2 4.67sec 1888 0 Direct 177.5 527 1054 630 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.16 177.47 0.00 0.00 0.0000 0.0000 111702.81 111702.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 143.10 105 188 527.43 316 664 526.93 485 569 75464 75464 0.00%
crit 19.37% 34.37 18 54 1054.48 633 1329 1053.34 929 1181 36239 36239 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4628 42.0% 149.2 1.98sec 9326 7506 Direct 447.5 2604 5218 3109 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.15 447.45 0.00 0.00 1.2425 0.0000 1391048.26 1391048.26 0.00% 7506.03 7506.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 361.03 273 452 2604.48 1958 5756 2604.40 2504 2710 940130 940130 0.00%
crit 19.31% 86.42 54 123 5218.22 3916 11512 5218.97 4528 5799 450918 450918 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:149.14
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (841) 0.0% (7.6%) 12.8 24.18sec 19745 15849

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.81 0.00 0.00 0.00 1.2459 0.0000 0.00 0.00 0.00% 15848.69 15848.69

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.82
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 841 7.6% 38.4 24.18sec 6591 0 Direct 38.4 5526 11079 6595 19.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.38 38.38 0.00 0.00 0.0000 0.0000 252992.70 252992.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 31.01 18 43 5525.72 3869 8938 5523.44 5015 6081 171312 171312 0.00%
crit 19.20% 7.37 0 17 11078.77 7739 17876 11069.87 0 17064 81681 81681 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.6%) 14.7 1.74sec 1386 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.6% 14.7 1.74sec 1386 0 Direct 14.7 1164 2327 1386 19.1%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.67 14.67 0.00 0.00 0.0000 0.0000 20330.08 20330.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 11.87 5 19 1163.53 1164 1164 1163.53 1164 1164 13813 13813 0.00%
crit 19.09% 2.80 0 8 2327.06 2327 2327 2212.68 0 2327 6517 6517 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1799 21.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1799.57 1799.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.46% 0.78 0 1 1480.68 1481 1481 1161.78 0 1481 1162 1162 0.00%
crit 21.54% 0.22 0 1 2961.35 2961 2961 637.79 0 2961 638 638 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.2%) 1.0 0.00sec 6094 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 152  / 21 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6093.75 6093.75 0.00% 51.74 51.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 72.71 60 85 56.81 43 60 56.81 56 58 4130 4130 0.00%
crit 19.22% 17.29 5 30 113.52 86 120 113.51 101 120 1964 1964 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 189 1.7% 9.3 33.70sec 6126 4810 Direct 9.3 3039 6105 3646 19.8%
Periodic 60.4 320 638 381 19.2% 10.1%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.26 9.26 60.36 60.36 1.2737 1.5113 56742.40 56742.40 0.00% 550.82 4810.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.24% 7.43 3 11 3039.44 2693 5655 3038.63 2693 4093 22583 22583 0.00%
crit 19.76% 1.83 0 7 6104.89 5386 11310 5357.29 0 11310 11181 11181 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.84% 48.79 33 65 319.76 34 501 319.28 288 351 15597 15597 0.00%
crit 19.16% 11.57 2 21 638.11 68 1003 636.81 382 1003 7382 7382 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.55
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.77
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.99
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (907) 0.0% (8.2%) 5.9 54.24sec 46071 36690

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.91 0.00 0.00 0.00 1.2558 0.0000 0.00 0.00 0.00% 36690.30 36690.30

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.93
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 907 8.2% 5.9 54.11sec 46071 0 Direct 17.7 15387 0 15387 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.91 17.70 0.00 0.00 0.0000 0.0000 272352.11 272352.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 17.70 12 21 15387.46 109 57628 15393.52 11071 18963 272352 272352 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:33106.94
  • base_dd_max:33106.94
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
pet - bron 72 / 15
melee 72 0.1% 18.8 9.07sec 241 185 Direct 18.8 202 404 241 19.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.85 18.85 0.00 0.00 1.3019 0.0000 4536.53 6479.98 29.99% 184.86 184.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.01% 15.27 10 25 202.37 176 247 202.26 182 223 3090 4414 29.99%
crit 18.99% 3.58 0 9 404.06 353 494 396.03 0 494 1446 2066 29.43%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
Kyrian_Forgelite
Arcane Power 2.8 132.14sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.79
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 263.81sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.79
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.0 166.91sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 5.98 0.00 4.3084 0.7222 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:1.00
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 52.86sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.77 0.00 0.00 0.00 1.2545 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.80
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 122.69sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.76
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
pet - bron
Anima Cannon 8.3 22.08sec

Stats Details: Anima Cannon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.33 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Anima Cannon

  • id:332525
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:8.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332525
  • name:Anima Cannon
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:8.33
Vitalizing Bolt (goliath_support) 14.6 11.95sec

Stats Details: Goliath Support

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 14.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Goliath Support

  • id:332526
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:4.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite_bron
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332526
  • name:Vitalizing Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:14.60
Smash 8.2 21.91sec

Stats Details: Smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.24 0.00 0.00 0.00 2.1709 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Smash

  • id:341163
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:3.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:341163
  • name:Smash
  • school:physical
  • tooltip:
  • description:Attacks the ground with a heavy smash, inflicting Arcane damage to all enemies in a cone in front of the caster.

Action Priority List

    default
    [ ]:8.33

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 56.2 150.0 5.3sec 1.4sec 3.9sec 72.20% 0.00% 0.1 (0.2) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.74%
  • arcane_charge_2:15.99%
  • arcane_charge_3:16.10%
  • arcane_charge_4:21.37%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 131.6sec 131.6sec 14.7sec 13.62% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 138.9s
  • trigger_min/max:120.4s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:13.62%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 262.9sec 262.9sec 11.8sec 6.90% 23.21% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:241.0s / 272.0s
  • trigger_min/max:241.0s / 272.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • berserking_1:6.90%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bron's Call to Action 3.2 238.5 110.3sec 1.2sec 93.0sec 99.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_brons_call_to_action
  • max_stacks:89
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:100.0s / 120.8s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 120.8s

Stack Uptimes

  • brons_call_to_action_1:1.57%
  • brons_call_to_action_2:1.32%
  • brons_call_to_action_3:0.81%
  • brons_call_to_action_4:0.93%
  • brons_call_to_action_5:0.95%
  • brons_call_to_action_6:1.40%
  • brons_call_to_action_7:1.29%
  • brons_call_to_action_8:1.20%
  • brons_call_to_action_9:1.24%
  • brons_call_to_action_10:1.27%
  • brons_call_to_action_11:1.53%
  • brons_call_to_action_12:1.07%
  • brons_call_to_action_13:1.67%
  • brons_call_to_action_14:1.14%
  • brons_call_to_action_15:0.80%
  • brons_call_to_action_16:1.20%
  • brons_call_to_action_17:1.19%
  • brons_call_to_action_18:1.20%
  • brons_call_to_action_19:1.21%
  • brons_call_to_action_20:1.23%
  • brons_call_to_action_21:1.19%
  • brons_call_to_action_22:1.59%
  • brons_call_to_action_23:0.87%
  • brons_call_to_action_24:1.03%
  • brons_call_to_action_25:1.19%
  • brons_call_to_action_26:1.21%
  • brons_call_to_action_27:1.54%
  • brons_call_to_action_28:0.88%
  • brons_call_to_action_29:0.69%
  • brons_call_to_action_30:1.07%
  • brons_call_to_action_31:1.15%
  • brons_call_to_action_32:1.16%
  • brons_call_to_action_33:1.11%
  • brons_call_to_action_34:1.28%
  • brons_call_to_action_35:1.12%
  • brons_call_to_action_36:1.30%
  • brons_call_to_action_37:0.58%
  • brons_call_to_action_38:0.90%
  • brons_call_to_action_39:1.07%
  • brons_call_to_action_40:1.06%
  • brons_call_to_action_41:1.06%
  • brons_call_to_action_42:1.05%
  • brons_call_to_action_43:1.04%
  • brons_call_to_action_44:1.04%
  • brons_call_to_action_45:1.06%
  • brons_call_to_action_46:1.16%
  • brons_call_to_action_47:1.22%
  • brons_call_to_action_48:1.15%
  • brons_call_to_action_49:1.12%
  • brons_call_to_action_50:1.11%
  • brons_call_to_action_51:1.13%
  • brons_call_to_action_52:1.41%
  • brons_call_to_action_53:1.18%
  • brons_call_to_action_54:1.13%
  • brons_call_to_action_55:0.94%
  • brons_call_to_action_56:1.02%
  • brons_call_to_action_57:1.14%
  • brons_call_to_action_58:1.08%
  • brons_call_to_action_59:1.11%
  • brons_call_to_action_60:1.12%
  • brons_call_to_action_61:1.16%
  • brons_call_to_action_62:1.06%
  • brons_call_to_action_63:1.09%
  • brons_call_to_action_64:1.56%
  • brons_call_to_action_65:1.09%
  • brons_call_to_action_66:1.10%
  • brons_call_to_action_67:0.53%
  • brons_call_to_action_68:1.06%
  • brons_call_to_action_69:1.08%
  • brons_call_to_action_70:1.09%
  • brons_call_to_action_71:1.17%
  • brons_call_to_action_72:0.99%
  • brons_call_to_action_73:1.07%
  • brons_call_to_action_74:1.00%
  • brons_call_to_action_75:1.04%
  • brons_call_to_action_76:1.25%
  • brons_call_to_action_77:0.80%
  • brons_call_to_action_78:1.03%
  • brons_call_to_action_79:1.06%
  • brons_call_to_action_80:1.02%
  • brons_call_to_action_81:1.01%
  • brons_call_to_action_82:1.04%
  • brons_call_to_action_83:1.07%
  • brons_call_to_action_84:1.06%
  • brons_call_to_action_85:1.02%
  • brons_call_to_action_86:1.14%
  • brons_call_to_action_87:1.05%
  • brons_call_to_action_88:1.40%
  • brons_call_to_action_89:0.51%

Spelldata

  • id:332514
  • name:Bron's Call to Action
  • tooltip:Bron arrives in ${{$332514u=89}+1-$w1} damaging or healing spells or abilities.
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}
  • max_stacks:89
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 23.8 0.2 12.2sec 12.1sec 2.1sec 16.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.17%
  • clearcasting_2:0.22%
  • clearcasting_3:0.04%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.0 0.0 174.6sec 174.6sec 4.3sec 1.44% 0.00% 4.0 (4.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:107.6s / 240.8s
  • trigger_min/max:107.6s / 240.8s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:1.44%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.42% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.42%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.5sec 36.5sec 14.7sec 41.78% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 55.3s
  • trigger_min/max:16.8s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • rune_of_power_1:41.78%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.39% 0.82% 7.02% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.737120.053239.903
Evocation166.14617.562336.586225.882132.015349.009
Rune of Power8.5781.13929.92251.56031.84977.462
Touch of the Magi7.0951.13929.91644.50030.54476.155
Arcane Power8.2560.35818.92423.6532.70534.274
Arcane Barrage2.9220.0039.584163.356128.897197.033
Arcane Orb4.0680.01511.79352.61640.05368.918
Radiant Spark2.4150.00022.28023.2589.70958.625

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Forgelite
mana_regen Mana 622.89 369746.74 64.88% 593.60 10738.46 2.82%
Evocation Mana 47.76 48095.09 8.44% 1007.08 0.00 0.00%
Mana Gem Mana 2.76 17459.25 3.06% 6337.14 0.00 0.00%
Arcane Barrage Mana 55.50 134586.18 23.62% 2425.19 6086.11 4.33%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1895.27 1994.90 16814.2 33409.0 337.1 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Forgelite
arcane_explosion Mana 149.1 569180.6 3816.4 3816.1 2.4
arcane_orb Mana 12.8 5728.2 447.0 447.1 44.2
radiant_spark Mana 9.3 9128.2 985.5 985.6 6.2
touch_of_the_magi Mana 5.9 14781.9 2500.0 2500.5 18.4

Statistics & Data Analysis

Fight Length
Kyrian_Forgelite Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Kyrian_Forgelite Damage Per Second
Count 1119
Mean 11013.66
Minimum 10103.79
Maximum 11941.09
Spread ( max - min ) 1837.31
Range [ ( max - min ) / 2 * 100% ] 8.34%
Standard Deviation 295.6426
5th Percentile 10524.34
95th Percentile 11494.24
( 95th Percentile - 5th Percentile ) 969.91
Mean Distribution
Standard Deviation 8.8380
95.00% Confidence Interval ( 10996.34 - 11030.98 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2769
0.1 Scale Factor Error with Delta=300 747
0.05 Scale Factor Error with Delta=300 2985
0.01 Scale Factor Error with Delta=300 74614
Priority Target DPS
Kyrian_Forgelite Priority Target Damage Per Second
Count 1119
Mean 4893.39
Minimum 4416.64
Maximum 5518.12
Spread ( max - min ) 1101.49
Range [ ( max - min ) / 2 * 100% ] 11.25%
Standard Deviation 176.6478
5th Percentile 4608.42
95th Percentile 5190.53
( 95th Percentile - 5th Percentile ) 582.10
Mean Distribution
Standard Deviation 5.2807
95.00% Confidence Interval ( 4883.04 - 4903.74 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5007
0.1 Scale Factor Error with Delta=300 267
0.05 Scale Factor Error with Delta=300 1066
0.01 Scale Factor Error with Delta=300 26638
DPS(e)
Kyrian_Forgelite Damage Per Second (Effective)
Count 1119
Mean 11013.66
Minimum 10103.79
Maximum 11941.09
Spread ( max - min ) 1837.31
Range [ ( max - min ) / 2 * 100% ] 8.34%
Damage
Kyrian_Forgelite Damage
Count 1119
Mean 3301278.78
Minimum 2512484.82
Maximum 4144027.08
Spread ( max - min ) 1631542.26
Range [ ( max - min ) / 2 * 100% ] 24.71%
DTPS
Kyrian_Forgelite Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Forgelite Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Forgelite Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Forgelite Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Forgelite Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Forgelite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_ForgeliteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Forgelite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.55 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.77 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.99 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.93 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.79 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.80 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.82 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 149.14 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.50 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 1.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.76 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.79 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqtqrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqtrprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqsqrjprqqqqrqqqqrmorqqqqrprqjqqqrqqqqrqqqqrprqqqqrqqqqtrkmnvrqqqqrprqqqqrqqqqorqqqqrjprqqqqrqqqqrqqqqrprqqqq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Forgelite 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Forgelite 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe m touch_of_the_magi Fluffy_Pillow 62377.8/63371: 98% mana bloodlust
0:02.312 aoe n arcane_power Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4)
0:02.312 shared_cds u potion Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:02.312 shared_cds v berserking Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.312 aoe r arcane_barrage Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.226 aoe p arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.139 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.053 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.968 aoe q arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:06.880 aoe q arcane_explosion Fluffy_Pillow 63187.0/63371: 100% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.796 aoe q arcane_explosion Fluffy_Pillow 61848.0/63371: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.711 aoe r arcane_barrage Fluffy_Pillow 60507.7/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.625 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.539 aoe q arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.453 aoe q arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.369 aoe q arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.284 aoe r arcane_barrage Fluffy_Pillow 58008.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.199 aoe q arcane_explosion Fluffy_Pillow 61703.5/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.114 aoe q arcane_explosion Fluffy_Pillow 60363.2/63371: 95% mana bloodlust, arcane_charge, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:16.121 aoe q arcane_explosion Fluffy_Pillow 61639.5/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.127 aoe q arcane_explosion Fluffy_Pillow 60414.5/63371: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:18.133 aoe o rune_of_power Fluffy_Pillow 59189.6/63371: 93% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.139 aoe r arcane_barrage Fluffy_Pillow 60464.6/63371: 95% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.147 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.153 aoe q arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.159 aoe q arcane_explosion Fluffy_Pillow 55921.5/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.165 shared_cds t use_mana_gem Kyrian_Forgelite 52196.5/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.165 aoe q arcane_explosion Fluffy_Pillow 58533.7/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.171 aoe r arcane_barrage Fluffy_Pillow 54808.7/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.177 aoe p arcane_orb Fluffy_Pillow 58618.6/63371: 93% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.184 aoe r arcane_barrage Fluffy_Pillow 59394.9/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.192 aoe q arcane_explosion Fluffy_Pillow 63207.3/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.200 aoe q arcane_explosion Fluffy_Pillow 59484.9/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.208 aoe q arcane_explosion Fluffy_Pillow 55762.5/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.213 aoe q arcane_explosion Fluffy_Pillow 52036.2/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:31.219 aoe r arcane_barrage Fluffy_Pillow 48311.3/63371: 76% mana bloodlust, arcane_charge(4), rune_of_power
0:32.227 aoe j radiant_spark Fluffy_Pillow 52123.7/63371: 82% mana bloodlust, rune_of_power
0:33.235 aoe q arcane_explosion Fluffy_Pillow 52401.2/63371: 83% mana bloodlust, rune_of_power
0:34.242 aoe q arcane_explosion Fluffy_Pillow 48677.5/63371: 77% mana bloodlust, arcane_charge, clearcasting
0:35.248 aoe q arcane_explosion Fluffy_Pillow 49952.6/63371: 79% mana bloodlust, arcane_charge(2)
0:36.254 aoe q arcane_explosion Fluffy_Pillow 46227.6/63371: 73% mana bloodlust, arcane_charge(3)
0:37.260 aoe r arcane_barrage Fluffy_Pillow 42502.6/63371: 67% mana bloodlust, arcane_charge(4)
0:38.266 aoe q arcane_explosion Fluffy_Pillow 46312.5/63371: 73% mana bloodlust
0:39.272 aoe q arcane_explosion Fluffy_Pillow 42587.6/63371: 67% mana bloodlust, arcane_charge, clearcasting
0:40.278 aoe q arcane_explosion Fluffy_Pillow 43862.6/63371: 69% mana bloodlust, arcane_charge(2)
0:41.283 aoe q arcane_explosion Fluffy_Pillow 40136.4/63371: 63% mana arcane_charge(3)
0:42.589 aoe r arcane_barrage Fluffy_Pillow 36791.6/63371: 58% mana arcane_charge(4)
0:43.893 aoe q arcane_explosion Fluffy_Pillow 40979.2/63371: 65% mana
0:45.200 aoe q arcane_explosion Fluffy_Pillow 37635.7/63371: 59% mana arcane_charge
0:46.505 aoe q arcane_explosion Fluffy_Pillow 34289.7/63371: 54% mana arcane_charge(2)
0:47.811 aoe q arcane_explosion Fluffy_Pillow 30945.0/63371: 49% mana arcane_charge(3)
0:49.116 aoe r arcane_barrage Fluffy_Pillow 27599.0/63371: 44% mana arcane_charge(4)
0:50.421 aoe p arcane_orb Fluffy_Pillow 31787.8/63371: 50% mana
0:51.729 aoe r arcane_barrage Fluffy_Pillow 32945.6/63371: 52% mana arcane_charge(4)
0:53.035 aoe q arcane_explosion Fluffy_Pillow 37135.8/63371: 59% mana
0:54.342 aoe q arcane_explosion Fluffy_Pillow 33792.3/63371: 53% mana arcane_charge
0:55.649 aoe q arcane_explosion Fluffy_Pillow 30448.8/63371: 48% mana arcane_charge(2)
0:56.956 aoe q arcane_explosion Fluffy_Pillow 27105.3/63371: 43% mana arcane_charge(3)
0:58.262 aoe r arcane_barrage Fluffy_Pillow 23760.6/63371: 37% mana arcane_charge(4)
0:59.569 aoe q arcane_explosion Fluffy_Pillow 27952.0/63371: 44% mana
1:00.874 aoe q arcane_explosion Fluffy_Pillow 24606.0/63371: 39% mana arcane_charge
1:02.180 aoe q arcane_explosion Fluffy_Pillow 21261.3/63371: 34% mana arcane_charge(2)
1:03.486 aoe q arcane_explosion Fluffy_Pillow 17916.5/63371: 28% mana arcane_charge(3)
1:04.793 aoe r arcane_barrage Fluffy_Pillow 14573.0/63371: 23% mana arcane_charge(4)
1:06.100 aoe k radiant_spark Fluffy_Pillow 18764.4/63371: 30% mana
1:07.407 aoe m touch_of_the_magi Fluffy_Pillow 19421.0/63371: 31% mana
1:08.714 aoe o rune_of_power Fluffy_Pillow 18577.5/63371: 29% mana arcane_charge(4)
1:10.020 aoe r arcane_barrage Fluffy_Pillow 20232.8/63371: 32% mana arcane_charge(4), rune_of_power
1:11.324 aoe p arcane_orb Fluffy_Pillow 24420.3/63371: 39% mana rune_of_power
1:12.630 aoe r arcane_barrage Fluffy_Pillow 25575.6/63371: 40% mana arcane_charge(4), rune_of_power
1:13.936 aoe q arcane_explosion Fluffy_Pillow 29765.7/63371: 47% mana rune_of_power
1:15.244 aoe q arcane_explosion Fluffy_Pillow 26423.5/63371: 42% mana arcane_charge, clearcasting, rune_of_power
1:16.550 aoe q arcane_explosion Fluffy_Pillow 28078.8/63371: 44% mana arcane_charge(2), rune_of_power
1:17.857 aoe q arcane_explosion Fluffy_Pillow 24735.3/63371: 39% mana arcane_charge(3), rune_of_power
1:19.163 aoe r arcane_barrage Fluffy_Pillow 21390.6/63371: 34% mana arcane_charge(4), rune_of_power
1:20.469 aoe q arcane_explosion Fluffy_Pillow 25580.7/63371: 40% mana rune_of_power
1:21.774 aoe q arcane_explosion Fluffy_Pillow 22234.7/63371: 35% mana arcane_charge, rune_of_power
1:23.080 aoe q arcane_explosion Fluffy_Pillow 18889.9/63371: 30% mana arcane_charge(2), rune_of_power
1:24.387 aoe q arcane_explosion Fluffy_Pillow 15546.5/63371: 25% mana arcane_charge(3), rune_of_power
1:25.693 aoe r arcane_barrage Fluffy_Pillow 12201.7/63371: 19% mana arcane_charge(4)
1:27.000 aoe q arcane_explosion Fluffy_Pillow 16393.1/63371: 26% mana
1:28.307 aoe q arcane_explosion Fluffy_Pillow 13049.6/63371: 21% mana arcane_charge
1:29.613 aoe q arcane_explosion Fluffy_Pillow 9704.9/63371: 15% mana arcane_charge(2), clearcasting
1:30.920 aoe q arcane_explosion Fluffy_Pillow 11361.4/63371: 18% mana arcane_charge(3)
1:32.226 aoe r arcane_barrage Fluffy_Pillow 8016.7/63371: 13% mana arcane_charge(4)
1:33.531 aoe p arcane_orb Fluffy_Pillow 12205.5/63371: 19% mana
1:34.840 aoe r arcane_barrage Fluffy_Pillow 13364.6/63371: 21% mana arcane_charge(4)
1:36.146 aoe q arcane_explosion Fluffy_Pillow 17554.7/63371: 28% mana
1:37.454 aoe j radiant_spark Fluffy_Pillow 14212.5/63371: 22% mana arcane_charge
1:38.760 aoe q arcane_explosion Fluffy_Pillow 14867.8/63371: 23% mana arcane_charge
1:40.065 aoe q arcane_explosion Fluffy_Pillow 11521.8/63371: 18% mana arcane_charge(2)
1:41.373 aoe q arcane_explosion Fluffy_Pillow 8179.6/63371: 13% mana arcane_charge(3), brons_call_to_action
1:42.679 aoe r arcane_barrage Fluffy_Pillow 4834.8/63371: 8% mana arcane_charge(4), clearcasting, brons_call_to_action(2)
1:43.985 aoe q arcane_explosion Fluffy_Pillow 9025.0/63371: 14% mana clearcasting, brons_call_to_action(3)
1:45.291 aoe q arcane_explosion Fluffy_Pillow 10680.2/63371: 17% mana arcane_charge, brons_call_to_action(4)
1:46.596 aoe q arcane_explosion Fluffy_Pillow 7334.2/63371: 12% mana arcane_charge(2), clearcasting, brons_call_to_action(5)
1:47.903 aoe q arcane_explosion Fluffy_Pillow 8990.7/63371: 14% mana arcane_charge(3), brons_call_to_action(6)
1:49.209 aoe r arcane_barrage Fluffy_Pillow 5646.0/63371: 9% mana arcane_charge(4), clearcasting, brons_call_to_action(7)
1:50.517 aoe q arcane_explosion Fluffy_Pillow 9838.7/63371: 16% mana clearcasting, brons_call_to_action(8)
1:51.823 aoe q arcane_explosion Fluffy_Pillow 11493.9/63371: 18% mana arcane_charge, brons_call_to_action(9)
1:53.129 aoe q arcane_explosion Fluffy_Pillow 8149.2/63371: 13% mana arcane_charge(2), clearcasting, brons_call_to_action(10)
1:54.435 aoe q arcane_explosion Fluffy_Pillow 9804.4/63371: 15% mana arcane_charge(3), brons_call_to_action(11)
1:55.742 aoe r arcane_barrage Fluffy_Pillow 6461.0/63371: 10% mana arcane_charge(4), brons_call_to_action(12)
1:57.048 aoe m touch_of_the_magi Fluffy_Pillow 10651.1/63371: 17% mana brons_call_to_action(13)
1:58.353 aoe o rune_of_power Fluffy_Pillow 9805.1/63371: 15% mana arcane_charge(4), brons_call_to_action(14)
1:59.659 aoe r arcane_barrage Fluffy_Pillow 11460.4/63371: 18% mana arcane_charge(4), rune_of_power, brons_call_to_action(15)
2:00.965 aoe p arcane_orb Fluffy_Pillow 15650.5/63371: 25% mana rune_of_power, brons_call_to_action(16)
2:02.272 aoe r arcane_barrage Fluffy_Pillow 16807.0/63371: 27% mana arcane_charge(4), rune_of_power, brons_call_to_action(17)
2:03.578 aoe q arcane_explosion Fluffy_Pillow 20997.1/63371: 33% mana rune_of_power, brons_call_to_action(18)
2:04.884 aoe q arcane_explosion Fluffy_Pillow 17652.4/63371: 28% mana arcane_charge, rune_of_power, brons_call_to_action(19)
2:06.189 aoe q arcane_explosion Fluffy_Pillow 14306.4/63371: 23% mana arcane_charge(2), rune_of_power, brons_call_to_action(20)
2:07.495 aoe q arcane_explosion Fluffy_Pillow 10961.6/63371: 17% mana arcane_charge(3), rune_of_power, brons_call_to_action(21)
2:08.801 aoe r arcane_barrage Fluffy_Pillow 7616.9/63371: 12% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(22)
2:10.109 aoe q arcane_explosion Fluffy_Pillow 11809.6/63371: 19% mana clearcasting, rune_of_power, brons_call_to_action(23)
2:11.416 aoe q arcane_explosion Fluffy_Pillow 13466.1/63371: 21% mana arcane_charge, rune_of_power, brons_call_to_action(24)
2:12.722 aoe q arcane_explosion Fluffy_Pillow 10121.3/63371: 16% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(25)
2:14.030 aoe q arcane_explosion Fluffy_Pillow 11779.1/63371: 19% mana arcane_charge(3), rune_of_power, brons_call_to_action(26)
2:15.335 aoe l radiant_spark Fluffy_Pillow 8433.1/63371: 13% mana arcane_charge(4), brons_call_to_action(27)
2:16.642 aoe n arcane_power Fluffy_Pillow 9089.7/63371: 14% mana arcane_charge(4), brons_call_to_action(28)
2:16.642 aoe r arcane_barrage Fluffy_Pillow 9089.7/63371: 14% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(29)
2:17.950 aoe q arcane_explosion Fluffy_Pillow 13282.3/63371: 21% mana arcane_power, rune_of_power, brons_call_to_action(30)
2:19.257 aoe q arcane_explosion Fluffy_Pillow 12438.8/63371: 20% mana arcane_charge, arcane_power, rune_of_power, brons_call_to_action(31)
2:20.564 aoe q arcane_explosion Fluffy_Pillow 11595.4/63371: 18% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, brons_call_to_action(32)
2:21.871 aoe q arcane_explosion Fluffy_Pillow 13251.9/63371: 21% mana arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(33)
2:23.177 shared_cds t use_mana_gem Kyrian_Forgelite 12407.2/63371: 20% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(34)
2:23.177 aoe r arcane_barrage Fluffy_Pillow 18744.3/63371: 30% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(34)
2:24.484 aoe p arcane_orb Fluffy_Pillow 22935.7/63371: 36% mana arcane_power, rune_of_power, brons_call_to_action(35)
2:25.789 aoe r arcane_barrage Fluffy_Pillow 24339.7/63371: 38% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(36)
2:27.095 aoe q arcane_explosion Fluffy_Pillow 28529.8/63371: 45% mana arcane_power, rune_of_power, brons_call_to_action(37)
2:28.400 aoe q arcane_explosion Fluffy_Pillow 27683.8/63371: 44% mana arcane_charge, arcane_power, rune_of_power, brons_call_to_action(38)
2:29.710 aoe q arcane_explosion Fluffy_Pillow 26844.1/63371: 42% mana arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(39)
2:31.017 aoe q arcane_explosion Fluffy_Pillow 26000.7/63371: 41% mana arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(40)
2:32.324 aoe r arcane_barrage Fluffy_Pillow 25157.2/63371: 40% mana arcane_charge(4), brons_call_to_action(41)
2:33.632 aoe q arcane_explosion Fluffy_Pillow 29349.8/63371: 46% mana brons_call_to_action(42)
2:34.938 aoe q arcane_explosion Fluffy_Pillow 26005.1/63371: 41% mana arcane_charge, brons_call_to_action(43)
2:36.244 aoe q arcane_explosion Fluffy_Pillow 22660.4/63371: 36% mana arcane_charge(2), brons_call_to_action(44)
2:37.552 aoe q arcane_explosion Fluffy_Pillow 19318.2/63371: 30% mana arcane_charge(3), brons_call_to_action(45)
2:38.859 aoe r arcane_barrage Fluffy_Pillow 15974.7/63371: 25% mana arcane_charge(4), brons_call_to_action(46)
2:40.165 aoe q arcane_explosion Fluffy_Pillow 20164.8/63371: 32% mana brons_call_to_action(47)
2:41.471 aoe q arcane_explosion Fluffy_Pillow 16820.1/63371: 27% mana arcane_charge, brons_call_to_action(48)
2:42.777 aoe q arcane_explosion Fluffy_Pillow 13475.3/63371: 21% mana arcane_charge(2), brons_call_to_action(49)
2:44.085 aoe q arcane_explosion Fluffy_Pillow 10133.1/63371: 16% mana arcane_charge(3), clearcasting, brons_call_to_action(50)
2:45.390 aoe r arcane_barrage Fluffy_Pillow 11787.1/63371: 19% mana arcane_charge(4), brons_call_to_action(51)
2:46.697 aoe k radiant_spark Fluffy_Pillow 15978.5/63371: 25% mana brons_call_to_action(52)
2:48.003 aoe m touch_of_the_magi Fluffy_Pillow 16633.8/63371: 26% mana brons_call_to_action(53)
2:49.309 aoe o rune_of_power Fluffy_Pillow 15789.0/63371: 25% mana arcane_charge(4), brons_call_to_action(54)
2:50.616 aoe r arcane_barrage Fluffy_Pillow 17445.6/63371: 28% mana arcane_charge(4), rune_of_power, brons_call_to_action(55)
2:51.924 aoe p arcane_orb Fluffy_Pillow 21638.2/63371: 34% mana rune_of_power, brons_call_to_action(56)
2:53.231 aoe r arcane_barrage Fluffy_Pillow 22794.7/63371: 36% mana arcane_charge(4), rune_of_power, brons_call_to_action(57)
2:54.538 aoe q arcane_explosion Fluffy_Pillow 26986.1/63371: 43% mana rune_of_power, brons_call_to_action(58)
2:55.844 aoe q arcane_explosion Fluffy_Pillow 23641.4/63371: 37% mana arcane_charge, rune_of_power, brons_call_to_action(59)
2:57.151 aoe q arcane_explosion Fluffy_Pillow 20297.9/63371: 32% mana arcane_charge(2), rune_of_power, brons_call_to_action(60)
2:58.456 aoe q arcane_explosion Fluffy_Pillow 16951.9/63371: 27% mana arcane_charge(3), rune_of_power, brons_call_to_action(61)
2:59.764 aoe r arcane_barrage Fluffy_Pillow 13609.7/63371: 21% mana arcane_charge(4), rune_of_power, brons_call_to_action(62)
3:01.070 aoe q arcane_explosion Fluffy_Pillow 17799.8/63371: 28% mana rune_of_power, brons_call_to_action(63)
3:02.377 aoe q arcane_explosion Fluffy_Pillow 14456.4/63371: 23% mana arcane_charge, rune_of_power, brons_call_to_action(64)
3:03.685 aoe q arcane_explosion Fluffy_Pillow 11114.2/63371: 18% mana arcane_charge(2), rune_of_power, brons_call_to_action(65)
3:04.992 aoe q arcane_explosion Fluffy_Pillow 7770.7/63371: 12% mana arcane_charge(3), rune_of_power, brons_call_to_action(66)
3:06.299 aoe r arcane_barrage Fluffy_Pillow 4427.2/63371: 7% mana arcane_charge(4), clearcasting, brons_call_to_action(67)
3:07.605 aoe q arcane_explosion Fluffy_Pillow 8617.3/63371: 14% mana clearcasting, brons_call_to_action(68)
3:08.913 aoe q arcane_explosion Fluffy_Pillow 10275.1/63371: 16% mana arcane_charge, brons_call_to_action(69)
3:10.220 aoe q arcane_explosion Fluffy_Pillow 6931.7/63371: 11% mana arcane_charge(2), brons_call_to_action(70)
3:11.527 aoe s evocation Kyrian_Forgelite 3588.2/63371: 6% mana arcane_charge(3), brons_call_to_action(71)
3:15.870 aoe q arcane_explosion Fluffy_Pillow 57431.6/63371: 91% mana arcane_charge(3), brons_call_to_action(71)
3:17.178 aoe r arcane_barrage Fluffy_Pillow 54089.4/63371: 85% mana arcane_charge(4), brons_call_to_action(72)
3:18.484 aoe j radiant_spark Fluffy_Pillow 58279.5/63371: 92% mana brons_call_to_action(73)
3:19.790 aoe p arcane_orb Fluffy_Pillow 58934.8/63371: 93% mana brons_call_to_action(74)
3:21.097 aoe r arcane_barrage Fluffy_Pillow 60091.3/63371: 95% mana arcane_charge(4), brons_call_to_action(75)
3:22.403 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana brons_call_to_action(76)
3:23.710 aoe q arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, brons_call_to_action(77)
3:25.017 aoe q arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), clearcasting, brons_call_to_action(78)
3:26.324 aoe q arcane_explosion Fluffy_Pillow 58341.0/63371: 92% mana arcane_charge(3), brons_call_to_action(79)
3:27.629 aoe r arcane_barrage Fluffy_Pillow 54995.0/63371: 87% mana arcane_charge(4), clearcasting, brons_call_to_action(80)
3:28.935 aoe q arcane_explosion Fluffy_Pillow 59185.1/63371: 93% mana clearcasting, brons_call_to_action(81)
3:30.240 aoe q arcane_explosion Fluffy_Pillow 60839.1/63371: 96% mana arcane_charge, brons_call_to_action(82)
3:31.546 aoe q arcane_explosion Fluffy_Pillow 57494.4/63371: 91% mana arcane_charge(2), brons_call_to_action(83)
3:32.854 aoe q arcane_explosion Fluffy_Pillow 54152.2/63371: 85% mana arcane_charge(3), brons_call_to_action(84)
3:34.160 aoe r arcane_barrage Fluffy_Pillow 50807.4/63371: 80% mana arcane_charge(4), brons_call_to_action(85)
3:35.465 aoe m touch_of_the_magi Fluffy_Pillow 54996.3/63371: 87% mana brons_call_to_action(86)
3:36.772 aoe o rune_of_power Fluffy_Pillow 54152.8/63371: 85% mana arcane_charge(4), clearcasting, brons_call_to_action(87)
3:38.077 aoe r arcane_barrage Fluffy_Pillow 55806.8/63371: 88% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(88)
3:39.385 aoe q arcane_explosion Fluffy_Pillow 59999.5/63371: 95% mana clearcasting, rune_of_power, brons_call_to_action(89)
3:40.691 aoe q arcane_explosion Fluffy_Pillow 61654.7/63371: 97% mana arcane_charge, rune_of_power
3:41.998 aoe q arcane_explosion Fluffy_Pillow 58311.3/63371: 92% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action
3:43.304 aoe q arcane_explosion Fluffy_Pillow 59966.5/63371: 95% mana arcane_charge(3), rune_of_power, brons_call_to_action(2)
3:44.609 aoe r arcane_barrage Fluffy_Pillow 56620.5/63371: 89% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(3)
3:45.917 aoe p arcane_orb Fluffy_Pillow 60813.2/63371: 96% mana clearcasting, rune_of_power, brons_call_to_action(4)
3:47.223 aoe r arcane_barrage Fluffy_Pillow 61968.4/63371: 98% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(5)
3:48.532 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power, brons_call_to_action(6)
3:49.840 aoe j radiant_spark Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, rune_of_power, brons_call_to_action(7)
3:51.147 aoe q arcane_explosion Fluffy_Pillow 62377.8/63371: 98% mana arcane_charge, rune_of_power, brons_call_to_action(8)
3:52.453 aoe q arcane_explosion Fluffy_Pillow 59033.0/63371: 93% mana arcane_charge(2), rune_of_power, brons_call_to_action(9)
3:53.759 aoe q arcane_explosion Fluffy_Pillow 55688.3/63371: 88% mana arcane_charge(3), brons_call_to_action(10)
3:55.067 aoe r arcane_barrage Fluffy_Pillow 52346.1/63371: 83% mana arcane_charge(4), brons_call_to_action(11)
3:56.375 aoe q arcane_explosion Fluffy_Pillow 56538.7/63371: 89% mana brons_call_to_action(12)
3:57.681 aoe q arcane_explosion Fluffy_Pillow 53194.0/63371: 84% mana arcane_charge, brons_call_to_action(13)
3:58.988 aoe q arcane_explosion Fluffy_Pillow 49850.5/63371: 79% mana arcane_charge(2), brons_call_to_action(14)
4:00.294 aoe q arcane_explosion Fluffy_Pillow 46505.8/63371: 73% mana arcane_charge(3), clearcasting, brons_call_to_action(15)
4:01.601 aoe r arcane_barrage Fluffy_Pillow 48162.3/63371: 76% mana arcane_charge(4), brons_call_to_action(16)
4:02.908 aoe q arcane_explosion Fluffy_Pillow 52353.7/63371: 83% mana brons_call_to_action(17)
4:04.214 aoe q arcane_explosion Fluffy_Pillow 49009.0/63371: 77% mana arcane_charge, brons_call_to_action(18)
4:05.522 aoe q arcane_explosion Fluffy_Pillow 45666.8/63371: 72% mana arcane_charge(2), brons_call_to_action(19)
4:06.829 aoe q arcane_explosion Fluffy_Pillow 42323.3/63371: 67% mana arcane_charge(3), brons_call_to_action(20)
4:08.134 aoe r arcane_barrage Fluffy_Pillow 38977.3/63371: 62% mana arcane_charge(4), brons_call_to_action(21)
4:09.441 aoe p arcane_orb Fluffy_Pillow 43168.7/63371: 68% mana brons_call_to_action(22)
4:10.747 aoe r arcane_barrage Fluffy_Pillow 44323.9/63371: 70% mana arcane_charge(4), brons_call_to_action(23)
4:12.054 aoe q arcane_explosion Fluffy_Pillow 48515.3/63371: 77% mana brons_call_to_action(24)
4:13.360 aoe q arcane_explosion Fluffy_Pillow 45170.6/63371: 71% mana arcane_charge, brons_call_to_action(25)
4:14.667 aoe q arcane_explosion Fluffy_Pillow 41827.1/63371: 66% mana arcane_charge(2), clearcasting, brons_call_to_action(26)
4:15.973 aoe q arcane_explosion Fluffy_Pillow 43482.4/63371: 69% mana arcane_charge(3), brons_call_to_action(27)
4:17.281 aoe r arcane_barrage Fluffy_Pillow 40140.2/63371: 63% mana arcane_charge(4), brons_call_to_action(28)
4:18.590 aoe q arcane_explosion Fluffy_Pillow 44334.1/63371: 70% mana brons_call_to_action(29)
4:19.897 aoe q arcane_explosion Fluffy_Pillow 40990.6/63371: 65% mana arcane_charge, brons_call_to_action(30)
4:21.204 aoe q arcane_explosion Fluffy_Pillow 37647.2/63371: 59% mana arcane_charge(2), brons_call_to_action(31)
4:22.509 aoe q arcane_explosion Fluffy_Pillow 34301.1/63371: 54% mana arcane_charge(3), brons_call_to_action(32)
4:23.815 shared_cds t use_mana_gem Kyrian_Forgelite 30956.4/63371: 49% mana arcane_charge(4), clearcasting, brons_call_to_action(33)
4:23.815 aoe r arcane_barrage Fluffy_Pillow 37293.6/63371: 59% mana arcane_charge(4), clearcasting, brons_call_to_action(33)
4:25.123 aoe k radiant_spark Fluffy_Pillow 41486.2/63371: 65% mana clearcasting, brons_call_to_action(34)
4:26.429 aoe m touch_of_the_magi Fluffy_Pillow 42141.5/63371: 66% mana clearcasting, brons_call_to_action(35)
4:27.735 aoe n arcane_power Fluffy_Pillow 41296.7/63371: 65% mana arcane_charge(4), clearcasting, brons_call_to_action(36)
4:27.735 shared_cds v berserking Fluffy_Pillow 41296.7/63371: 65% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(37)
4:27.735 aoe r arcane_barrage Fluffy_Pillow 41296.7/63371: 65% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(38)
4:28.924 aoe q arcane_explosion Fluffy_Pillow 45338.6/63371: 72% mana berserking, arcane_power, clearcasting, rune_of_power, brons_call_to_action(39)
4:30.112 aoe q arcane_explosion Fluffy_Pillow 46844.3/63371: 74% mana berserking, arcane_charge, arcane_power, rune_of_power, brons_call_to_action(40)
4:31.300 aoe q arcane_explosion Fluffy_Pillow 45850.0/63371: 72% mana berserking, arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(41)
4:32.489 aoe q arcane_explosion Fluffy_Pillow 44856.9/63371: 71% mana berserking, arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(42)
4:33.676 aoe r arcane_barrage Fluffy_Pillow 43861.4/63371: 69% mana berserking, arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(43)
4:34.865 aoe p arcane_orb Fluffy_Pillow 47903.2/63371: 76% mana berserking, arcane_power, rune_of_power, brons_call_to_action(44)
4:36.052 aoe r arcane_barrage Fluffy_Pillow 49157.6/63371: 78% mana berserking, arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(45)
4:37.240 aoe q arcane_explosion Fluffy_Pillow 53198.2/63371: 84% mana berserking, arcane_power, rune_of_power, brons_call_to_action(46)
4:38.426 aoe q arcane_explosion Fluffy_Pillow 52201.4/63371: 82% mana berserking, arcane_charge, arcane_power, rune_of_power, brons_call_to_action(47)
4:39.616 aoe q arcane_explosion Fluffy_Pillow 51209.6/63371: 81% mana berserking, arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(48)
4:40.804 aoe q arcane_explosion Fluffy_Pillow 50215.3/63371: 79% mana arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(49)
4:42.111 aoe r arcane_barrage Fluffy_Pillow 49371.9/63371: 78% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(50)
4:43.420 aoe q arcane_explosion Fluffy_Pillow 53565.8/63371: 85% mana brons_call_to_action(51)
4:44.725 aoe q arcane_explosion Fluffy_Pillow 50219.8/63371: 79% mana arcane_charge, brons_call_to_action(52)
4:46.031 aoe q arcane_explosion Fluffy_Pillow 46875.0/63371: 74% mana arcane_charge(2), clearcasting, brons_call_to_action(53)
4:47.336 aoe q arcane_explosion Fluffy_Pillow 48529.0/63371: 77% mana arcane_charge(3), brons_call_to_action(54)
4:48.642 aoe o rune_of_power Fluffy_Pillow 45184.3/63371: 71% mana arcane_charge(4), brons_call_to_action(55)
4:49.948 aoe r arcane_barrage Fluffy_Pillow 46839.5/63371: 74% mana arcane_charge(4), rune_of_power, brons_call_to_action(56)
4:51.254 aoe q arcane_explosion Fluffy_Pillow 51029.7/63371: 81% mana rune_of_power, brons_call_to_action(57)
4:52.560 aoe q arcane_explosion Fluffy_Pillow 47684.9/63371: 75% mana arcane_charge, rune_of_power, brons_call_to_action(58)
4:53.867 aoe q arcane_explosion Fluffy_Pillow 44341.5/63371: 70% mana arcane_charge(2), rune_of_power, brons_call_to_action(59)
4:55.172 aoe q arcane_explosion Fluffy_Pillow 40995.5/63371: 65% mana arcane_charge(3), clearcasting, rune_of_power, brons_call_to_action(60)
4:56.478 aoe r arcane_barrage Fluffy_Pillow 42650.7/63371: 67% mana arcane_charge(4), rune_of_power, brons_call_to_action(61)
4:57.784 aoe j radiant_spark Fluffy_Pillow 46840.8/63371: 74% mana rune_of_power, brons_call_to_action(62)
4:59.090 aoe p arcane_orb Fluffy_Pillow 47496.1/63371: 75% mana rune_of_power, brons_call_to_action(63)
5:00.394 aoe r arcane_barrage Fluffy_Pillow 48648.8/63371: 77% mana arcane_charge(4), rune_of_power, brons_call_to_action(64)
5:01.702 aoe q arcane_explosion Fluffy_Pillow 52841.5/63371: 83% mana rune_of_power, brons_call_to_action(65)
5:03.008 aoe q arcane_explosion Fluffy_Pillow 49496.7/63371: 78% mana arcane_charge, clearcasting, rune_of_power, brons_call_to_action(66)
5:04.315 aoe q arcane_explosion Fluffy_Pillow 51153.3/63371: 81% mana arcane_charge(2), rune_of_power, brons_call_to_action(67)
5:05.621 aoe q arcane_explosion Fluffy_Pillow 47808.5/63371: 75% mana arcane_charge(3), brons_call_to_action(68)
5:06.929 aoe r arcane_barrage Fluffy_Pillow 44466.3/63371: 70% mana arcane_charge(4), brons_call_to_action(69)
5:08.235 aoe q arcane_explosion Fluffy_Pillow 48656.4/63371: 77% mana brons_call_to_action(70)
5:09.542 aoe q arcane_explosion Fluffy_Pillow 45313.0/63371: 72% mana arcane_charge, brons_call_to_action(71)
5:10.849 aoe q arcane_explosion Fluffy_Pillow 41969.5/63371: 66% mana arcane_charge(2), brons_call_to_action(72)
5:12.156 aoe q arcane_explosion Fluffy_Pillow 38626.0/63371: 61% mana arcane_charge(3), brons_call_to_action(73)
5:13.462 aoe r arcane_barrage Fluffy_Pillow 35281.3/63371: 56% mana arcane_charge(4), clearcasting, brons_call_to_action(74)
5:14.767 aoe q arcane_explosion Fluffy_Pillow 39470.1/63371: 62% mana clearcasting, brons_call_to_action(75)
5:16.075 aoe q arcane_explosion Fluffy_Pillow 41127.9/63371: 65% mana arcane_charge, brons_call_to_action(76)
5:17.382 aoe q arcane_explosion Fluffy_Pillow 37784.5/63371: 60% mana arcane_charge(2), brons_call_to_action(77)
5:18.689 aoe q arcane_explosion Fluffy_Pillow 34441.0/63371: 54% mana arcane_charge(3), brons_call_to_action(78)
5:19.996 aoe r arcane_barrage Fluffy_Pillow 31097.5/63371: 49% mana arcane_charge(4), brons_call_to_action(79)
5:21.304 aoe p arcane_orb Fluffy_Pillow 35290.2/63371: 56% mana brons_call_to_action(80)
5:22.610 aoe r arcane_barrage Fluffy_Pillow 36445.4/63371: 58% mana arcane_charge(4), brons_call_to_action(81)
5:23.916 aoe q arcane_explosion Fluffy_Pillow 40635.6/63371: 64% mana brons_call_to_action(82)
5:25.222 aoe q arcane_explosion Fluffy_Pillow 37290.8/63371: 59% mana arcane_charge, brons_call_to_action(83)
5:26.528 aoe q arcane_explosion Fluffy_Pillow 33946.1/63371: 54% mana arcane_charge(2), brons_call_to_action(84)
5:27.834 aoe q arcane_explosion Fluffy_Pillow 30601.3/63371: 48% mana arcane_charge(3), brons_call_to_action(85)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Forgelite"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=333950//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Kyrian_Pelagos : 11155 dps, 4952 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11154.7 11154.7 18.3 / 0.164% 1214.0 / 10.9% 5.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
1996.0 1904.2 Mana 0.00% 49.5 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 11155
Arcane Barrage 4007 36.0% 55.5 5.41sec 21723 17428 Direct 166.4 6087 12123 7252 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.55 166.43 0.00 0.00 1.2464 0.0000 1206669.99 1206669.99 0.00% 17428.36 17428.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 134.30 95 177 6087.20 2082 31635 6072.24 5185 6749 817091 817091 0.00%
crit 19.31% 32.13 16 51 12123.18 4164 63270 12111.51 7781 17759 389579 389579 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.55
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 374 3.3% 59.4 4.70sec 1890 0 Direct 178.1 527 1057 630 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.37 178.10 0.00 0.00 0.0000 0.0000 112210.55 112210.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 143.51 100 189 527.37 316 664 526.67 486 568 75660 75660 0.00%
crit 19.42% 34.59 14 56 1056.70 633 1329 1055.50 915 1198 36550 36550 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4691 42.0% 149.3 1.98sec 9445 7601 Direct 447.8 2639 5279 3149 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.27 447.82 0.00 0.00 1.2426 0.0000 1409936.32 1409936.32 0.00% 7601.02 7601.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 361.38 279 454 2639.44 1958 6227 2639.59 2532 2747 953716 953716 0.00%
crit 19.30% 86.44 47 123 5279.47 3916 12454 5279.98 4715 5890 456221 456221 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:149.27
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (860) 0.0% (7.7%) 12.8 24.12sec 20202 16216

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.81 0.00 0.00 0.00 1.2458 0.0000 0.00 0.00 0.00% 16216.45 16216.45

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.81
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 860 7.7% 38.4 24.12sec 6747 0 Direct 38.4 5657 11336 6750 19.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.35 38.35 0.00 0.00 0.0000 0.0000 258765.83 258765.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 30.98 18 42 5656.87 3869 9669 5655.17 5048 6249 175224 175224 0.00%
crit 19.22% 7.37 0 15 11336.44 7739 19338 11320.05 0 16234 83542 83542 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.6%) 14.7 1.79sec 1388 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.6% 14.7 1.79sec 1388 0 Direct 14.7 1164 2327 1388 19.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.71 14.71 0.00 0.00 0.0000 0.0000 20409.11 20409.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 11.88 5 19 1163.53 1164 1164 1163.53 1164 1164 13819 13819 0.00%
crit 19.25% 2.83 0 8 2327.06 2327 2327 2198.13 0 2327 6590 6590 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1757 18.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1757.23 1757.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.32% 0.81 0 1 1480.68 1481 1481 1204.13 0 1481 1204 1204 0.00%
crit 18.68% 0.19 0 1 2961.35 2961 2961 553.10 0 2961 553 553 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.2%) 1.0 0.00sec 6111 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 153  / 21 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6110.63 6110.63 0.00% 51.88 51.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.46% 72.42 60 83 56.80 43 60 56.80 56 58 4113 4113 0.00%
crit 19.54% 17.58 7 30 113.61 86 120 113.60 103 120 1997 1997 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 189 1.7% 9.3 33.83sec 6099 4790 Direct 9.3 3032 6061 3618 19.3%
Periodic 60.5 320 640 381 19.0% 10.1%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.29 9.29 60.52 60.52 1.2733 1.5125 56671.25 56671.25 0.00% 548.21 4789.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 7.50 2 11 3032.29 2693 5655 3030.54 2693 3716 22728 22728 0.00%
crit 19.34% 1.80 0 7 6061.26 5386 11310 5195.39 0 11310 10888 10888 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.96% 49.00 29 68 320.16 34 501 319.72 283 352 15684 15684 0.00%
crit 19.04% 11.52 3 24 640.01 68 1003 639.20 430 919 7371 7371 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.55
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.79
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:1.00
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (939) 0.0% (8.4%) 5.9 54.14sec 47538 37855

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.93 0.00 0.00 0.00 1.2559 0.0000 0.00 0.00 0.00% 37855.16 37855.16

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.95
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 939 8.4% 5.9 54.02sec 47538 0 Direct 17.8 15860 0 15860 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.93 17.77 0.00 0.00 0.0000 0.0000 281831.70 281831.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 17.77 12 21 15860.06 109 59309 15861.73 10810 20246 281832 281832 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:36875.28
  • base_dd_max:36875.28
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Kyrian_Pelagos
Arcane Power 2.8 132.28sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.79
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 264.16sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.79
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.9 178.11sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.94 0.00 5.61 0.00 4.3102 0.7223 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:0.94
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 52.71sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.77 0.00 0.00 0.00 1.2545 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.79
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.63sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 56.3 150.1 5.3sec 1.4sec 3.9sec 72.16% 0.00% 0.1 (0.2) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.78%
  • arcane_charge_2:16.04%
  • arcane_charge_3:15.96%
  • arcane_charge_4:21.39%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 132.1sec 132.1sec 14.7sec 13.60% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.2s / 138.9s
  • trigger_min/max:120.2s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:13.60%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 263.8sec 263.8sec 11.7sec 6.89% 23.23% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:240.6s / 272.0s
  • trigger_min/max:240.6s / 272.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • berserking_1:6.89%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 23.9 0.2 12.1sec 12.1sec 2.1sec 16.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.16%
  • clearcasting_2:0.21%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Combat Meditation 4.9 0.0 67.7sec 67.7sec 7.9sec 12.82% 0.00% 9.6 (9.6) 4.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:0.50
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:350.00

Trigger Details

  • interval_min/max:62.7s / 88.0s
  • trigger_min/max:62.7s / 88.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • combat_meditation_1:12.82%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 0.9 0.0 168.5sec 168.5sec 4.3sec 1.35% 0.00% 3.7 (3.7) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:115.4s / 240.8s
  • trigger_min/max:115.4s / 240.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:1.35%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.42% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.42%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.6sec 36.6sec 14.7sec 41.77% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 55.3s
  • trigger_min/max:16.8s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • rune_of_power_1:41.77%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.46% 0.82% 6.78% 0.8s 0.0s 5.2s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.737120.053239.903
Evocation176.31025.392336.552232.848143.748354.612
Rune of Power8.4841.14129.91551.31731.84077.469
Touch of the Magi6.8951.14131.21343.68330.53676.162
Arcane Power8.5830.22618.93024.4812.71534.283
Arcane Barrage2.9180.0029.585163.252128.890198.389
Arcane Orb4.0840.01811.79352.74837.70868.922
Radiant Spark2.2920.00022.28322.2899.69458.830

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
mana_regen Mana 625.50 373410.13 65.22% 596.97 11708.77 3.04%
Evocation Mana 44.78 45151.78 7.89% 1008.23 0.00 0.00%
Mana Gem Mana 2.75 17857.24 3.12% 6485.75 0.00 0.00%
Arcane Barrage Mana 55.55 136149.51 23.78% 2451.10 6940.88 4.85%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1904.21 1995.98 18672.6 34618.2 692.9 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
arcane_explosion Mana 149.3 569442.7 3815.0 3814.8 2.5
arcane_orb Mana 12.8 5724.0 446.8 446.9 45.2
radiant_spark Mana 9.3 9184.1 987.9 988.4 6.2
touch_of_the_magi Mana 5.9 14823.8 2500.0 2500.4 19.0

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Kyrian_Pelagos Damage Per Second
Count 1119
Mean 11154.66
Minimum 10117.28
Maximum 12105.52
Spread ( max - min ) 1988.25
Range [ ( max - min ) / 2 * 100% ] 8.91%
Standard Deviation 312.0365
5th Percentile 10635.55
95th Percentile 11666.48
( 95th Percentile - 5th Percentile ) 1030.93
Mean Distribution
Standard Deviation 9.3280
95.00% Confidence Interval ( 11136.38 - 11172.95 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3007
0.1 Scale Factor Error with Delta=300 832
0.05 Scale Factor Error with Delta=300 3325
0.01 Scale Factor Error with Delta=300 83118
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 1119
Mean 4952.35
Minimum 4345.66
Maximum 5716.13
Spread ( max - min ) 1370.47
Range [ ( max - min ) / 2 * 100% ] 13.84%
Standard Deviation 185.7240
5th Percentile 4645.03
95th Percentile 5259.30
( 95th Percentile - 5th Percentile ) 614.26
Mean Distribution
Standard Deviation 5.5520
95.00% Confidence Interval ( 4941.47 - 4963.23 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5403
0.1 Scale Factor Error with Delta=300 295
0.05 Scale Factor Error with Delta=300 1178
0.01 Scale Factor Error with Delta=300 29446
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 1119
Mean 11154.66
Minimum 10117.28
Maximum 12105.52
Spread ( max - min ) 1988.25
Range [ ( max - min ) / 2 * 100% ] 8.91%
Damage
Kyrian_Pelagos Damage
Count 1119
Mean 3348251.98
Minimum 2524402.25
Maximum 4126940.07
Spread ( max - min ) 1602537.82
Range [ ( max - min ) / 2 * 100% ] 23.93%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.55 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.79 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 1.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.95 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.79 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.79 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.81 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 149.27 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.55 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 0.94 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.79 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqqrprqqqqtrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqrprqqqtqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrjqqqqrqqqqrprqqqsqrqqqqrkmnvrprqqqqrqqqqrqqqqtorprqqjqqrqqqqrqqqqrprqqqqrqqqq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana clearcasting
0:01.307 aoe m touch_of_the_magi Fluffy_Pillow 68283.7/69371: 98% mana bloodlust, clearcasting, combat_meditation
0:02.314 aoe n arcane_power Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, arcane_charge(4), clearcasting, combat_meditation
0:02.314 shared_cds u potion Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, combat_meditation
0:02.314 shared_cds v berserking Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:02.314 aoe r arcane_barrage Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:03.228 aoe p arcane_orb Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:04.143 aoe r arcane_barrage Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.057 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.971 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:06.887 aoe q arcane_explosion Fluffy_Pillow 68142.3/69371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:07.801 aoe q arcane_explosion Fluffy_Pillow 66910.4/69371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:08.715 aoe r arcane_barrage Fluffy_Pillow 65678.5/69371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:09.628 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.543 aoe q arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.457 aoe q arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.374 aoe q arcane_explosion Fluffy_Pillow 59351.8/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.288 aoe r arcane_barrage Fluffy_Pillow 58010.2/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:14.203 aoe q arcane_explosion Fluffy_Pillow 61704.8/63371: 97% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:15.116 aoe q arcane_explosion Fluffy_Pillow 62861.9/63371: 99% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.123 aoe q arcane_explosion Fluffy_Pillow 61638.2/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.130 aoe q arcane_explosion Fluffy_Pillow 60414.5/63371: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:18.136 aoe o rune_of_power Fluffy_Pillow 59189.6/63371: 93% mana bloodlust, arcane_charge(4), clearcasting, potion_of_deathly_fixation
0:19.142 aoe r arcane_barrage Fluffy_Pillow 60464.6/63371: 95% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:20.149 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:21.155 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.162 aoe q arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, potion_of_deathly_fixation
0:23.170 aoe q arcane_explosion Fluffy_Pillow 60925.3/63371: 96% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.178 aoe r arcane_barrage Fluffy_Pillow 57202.9/63371: 90% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:25.185 aoe p arcane_orb Fluffy_Pillow 61014.0/63371: 96% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:26.192 aoe r arcane_barrage Fluffy_Pillow 61790.3/63371: 98% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.200 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:28.207 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power
0:29.213 aoe q arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power
0:30.220 aoe q arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power
0:31.226 shared_cds t use_mana_gem Kyrian_Pelagos 52197.8/63371: 82% mana bloodlust, arcane_charge(4), rune_of_power
0:31.226 aoe r arcane_barrage Fluffy_Pillow 58534.9/63371: 92% mana bloodlust, arcane_charge(4), rune_of_power
0:32.232 aoe j radiant_spark Fluffy_Pillow 62344.8/63371: 98% mana bloodlust, rune_of_power
0:33.240 aoe q arcane_explosion Fluffy_Pillow 62379.0/63371: 98% mana bloodlust, rune_of_power
0:34.247 aoe q arcane_explosion Fluffy_Pillow 58655.3/63371: 93% mana bloodlust, arcane_charge
0:35.251 aoe q arcane_explosion Fluffy_Pillow 54927.8/63371: 87% mana bloodlust, arcane_charge(2)
0:36.259 aoe q arcane_explosion Fluffy_Pillow 51205.4/63371: 81% mana bloodlust, arcane_charge(3)
0:37.266 aoe r arcane_barrage Fluffy_Pillow 47481.7/63371: 75% mana bloodlust, arcane_charge(4)
0:38.271 aoe q arcane_explosion Fluffy_Pillow 51290.3/63371: 81% mana bloodlust
0:39.277 aoe q arcane_explosion Fluffy_Pillow 47565.4/63371: 75% mana bloodlust, arcane_charge
0:40.283 aoe q arcane_explosion Fluffy_Pillow 43840.4/63371: 69% mana bloodlust, arcane_charge(2)
0:41.289 aoe q arcane_explosion Fluffy_Pillow 40115.4/63371: 63% mana arcane_charge(3)
0:42.595 aoe r arcane_barrage Fluffy_Pillow 36770.7/63371: 58% mana arcane_charge(4)
0:43.901 aoe q arcane_explosion Fluffy_Pillow 40960.8/63371: 65% mana
0:45.209 aoe q arcane_explosion Fluffy_Pillow 37618.6/63371: 59% mana arcane_charge, clearcasting
0:46.518 aoe q arcane_explosion Fluffy_Pillow 39277.7/63371: 62% mana arcane_charge(2)
0:47.825 aoe q arcane_explosion Fluffy_Pillow 35934.2/63371: 57% mana arcane_charge(3)
0:49.132 aoe r arcane_barrage Fluffy_Pillow 32590.7/63371: 51% mana arcane_charge(4)
0:50.437 aoe p arcane_orb Fluffy_Pillow 36779.6/63371: 58% mana
0:51.743 aoe r arcane_barrage Fluffy_Pillow 37934.8/63371: 60% mana arcane_charge(4)
0:53.050 aoe q arcane_explosion Fluffy_Pillow 42126.2/63371: 66% mana
0:54.356 aoe q arcane_explosion Fluffy_Pillow 38781.5/63371: 61% mana arcane_charge, clearcasting
0:55.664 aoe q arcane_explosion Fluffy_Pillow 40439.3/63371: 64% mana arcane_charge(2)
0:56.971 aoe q arcane_explosion Fluffy_Pillow 37095.8/63371: 59% mana arcane_charge(3)
0:58.279 aoe r arcane_barrage Fluffy_Pillow 33753.6/63371: 53% mana arcane_charge(4), clearcasting
0:59.584 aoe q arcane_explosion Fluffy_Pillow 37942.5/63371: 60% mana clearcasting
1:00.890 aoe q arcane_explosion Fluffy_Pillow 39597.7/63371: 62% mana arcane_charge
1:02.196 aoe q arcane_explosion Fluffy_Pillow 36253.0/63371: 57% mana arcane_charge(2), clearcasting
1:03.503 aoe q arcane_explosion Fluffy_Pillow 37909.5/63371: 60% mana arcane_charge(3)
1:04.810 aoe r arcane_barrage Fluffy_Pillow 34566.0/63371: 55% mana arcane_charge(4)
1:06.115 aoe k radiant_spark Fluffy_Pillow 38754.9/63371: 61% mana
1:07.421 aoe m touch_of_the_magi Fluffy_Pillow 43141.5/69371: 62% mana combat_meditation
1:08.727 aoe o rune_of_power Fluffy_Pillow 42453.5/69371: 61% mana arcane_charge(4), combat_meditation
1:10.033 aoe r arcane_barrage Fluffy_Pillow 44265.5/69371: 64% mana arcane_charge(4), rune_of_power, combat_meditation
1:11.340 aoe p arcane_orb Fluffy_Pillow 48853.7/69371: 70% mana rune_of_power, combat_meditation
1:12.647 aoe r arcane_barrage Fluffy_Pillow 50167.1/69371: 72% mana arcane_charge(4), rune_of_power, combat_meditation
1:13.955 aoe q arcane_explosion Fluffy_Pillow 54756.7/69371: 79% mana rune_of_power, combat_meditation
1:15.260 aoe q arcane_explosion Fluffy_Pillow 51567.3/69371: 74% mana arcane_charge, rune_of_power, combat_meditation
1:16.566 aoe q arcane_explosion Fluffy_Pillow 44194.9/63371: 70% mana arcane_charge(2), rune_of_power
1:17.871 aoe q arcane_explosion Fluffy_Pillow 40848.9/63371: 64% mana arcane_charge(3), rune_of_power
1:19.177 aoe r arcane_barrage Fluffy_Pillow 37504.1/63371: 59% mana arcane_charge(4), rune_of_power
1:20.482 aoe q arcane_explosion Fluffy_Pillow 41693.0/63371: 66% mana rune_of_power
1:21.788 aoe q arcane_explosion Fluffy_Pillow 38348.3/63371: 61% mana arcane_charge, rune_of_power
1:23.093 aoe q arcane_explosion Fluffy_Pillow 35002.2/63371: 55% mana arcane_charge(2), rune_of_power
1:24.399 aoe q arcane_explosion Fluffy_Pillow 31657.5/63371: 50% mana arcane_charge(3), clearcasting, rune_of_power
1:25.705 aoe r arcane_barrage Fluffy_Pillow 33312.8/63371: 53% mana arcane_charge(4)
1:27.012 aoe q arcane_explosion Fluffy_Pillow 37504.2/63371: 59% mana
1:28.318 aoe q arcane_explosion Fluffy_Pillow 34159.4/63371: 54% mana arcane_charge
1:29.625 aoe q arcane_explosion Fluffy_Pillow 30815.9/63371: 49% mana arcane_charge(2)
1:30.930 aoe q arcane_explosion Fluffy_Pillow 27469.9/63371: 43% mana arcane_charge(3)
1:32.236 aoe r arcane_barrage Fluffy_Pillow 24125.2/63371: 38% mana arcane_charge(4)
1:33.543 aoe p arcane_orb Fluffy_Pillow 28316.6/63371: 45% mana
1:34.851 aoe r arcane_barrage Fluffy_Pillow 29474.4/63371: 47% mana arcane_charge(4)
1:36.157 aoe q arcane_explosion Fluffy_Pillow 33664.5/63371: 53% mana
1:37.462 aoe j radiant_spark Fluffy_Pillow 30318.5/63371: 48% mana arcane_charge
1:38.771 aoe q arcane_explosion Fluffy_Pillow 30977.6/63371: 49% mana arcane_charge
1:40.079 aoe q arcane_explosion Fluffy_Pillow 27635.4/63371: 44% mana arcane_charge(2)
1:41.386 aoe q arcane_explosion Fluffy_Pillow 24291.9/63371: 38% mana arcane_charge(3)
1:42.692 aoe r arcane_barrage Fluffy_Pillow 20947.2/63371: 33% mana arcane_charge(4), clearcasting
1:43.999 aoe q arcane_explosion Fluffy_Pillow 25138.5/63371: 40% mana clearcasting
1:45.305 aoe q arcane_explosion Fluffy_Pillow 26793.8/63371: 42% mana arcane_charge
1:46.611 aoe q arcane_explosion Fluffy_Pillow 23449.1/63371: 37% mana arcane_charge(2)
1:47.917 aoe q arcane_explosion Fluffy_Pillow 20104.3/63371: 32% mana arcane_charge(3), clearcasting
1:49.223 aoe r arcane_barrage Fluffy_Pillow 21759.6/63371: 34% mana arcane_charge(4)
1:50.530 aoe q arcane_explosion Fluffy_Pillow 25951.0/63371: 41% mana
1:51.837 aoe q arcane_explosion Fluffy_Pillow 22607.5/63371: 36% mana arcane_charge
1:53.143 aoe q arcane_explosion Fluffy_Pillow 19262.8/63371: 30% mana arcane_charge(2)
1:54.451 aoe q arcane_explosion Fluffy_Pillow 15920.6/63371: 25% mana arcane_charge(3), clearcasting
1:55.758 aoe r arcane_barrage Fluffy_Pillow 17577.1/63371: 28% mana arcane_charge(4)
1:57.064 aoe m touch_of_the_magi Fluffy_Pillow 21767.2/63371: 34% mana
1:58.371 aoe o rune_of_power Fluffy_Pillow 20923.7/63371: 33% mana arcane_charge(4)
1:59.676 aoe r arcane_barrage Fluffy_Pillow 22577.7/63371: 36% mana arcane_charge(4), rune_of_power
2:00.982 aoe p arcane_orb Fluffy_Pillow 26767.8/63371: 42% mana rune_of_power
2:02.288 aoe r arcane_barrage Fluffy_Pillow 27923.1/63371: 44% mana arcane_charge(4), rune_of_power
2:03.596 aoe q arcane_explosion Fluffy_Pillow 32115.8/63371: 51% mana rune_of_power
2:04.902 aoe q arcane_explosion Fluffy_Pillow 28771.0/63371: 45% mana arcane_charge, clearcasting, rune_of_power
2:06.207 aoe q arcane_explosion Fluffy_Pillow 30425.0/63371: 48% mana arcane_charge(2), rune_of_power
2:07.514 aoe q arcane_explosion Fluffy_Pillow 27081.5/63371: 43% mana arcane_charge(3), rune_of_power
2:08.821 aoe r arcane_barrage Fluffy_Pillow 23738.1/63371: 37% mana arcane_charge(4), rune_of_power
2:10.126 aoe q arcane_explosion Fluffy_Pillow 27926.9/63371: 44% mana rune_of_power
2:11.431 aoe q arcane_explosion Fluffy_Pillow 24580.9/63371: 39% mana arcane_charge, clearcasting, rune_of_power
2:12.737 aoe q arcane_explosion Fluffy_Pillow 26236.2/63371: 41% mana arcane_charge(2), rune_of_power
2:14.043 aoe q arcane_explosion Fluffy_Pillow 22891.4/63371: 36% mana arcane_charge(3), clearcasting, rune_of_power
2:15.349 aoe l radiant_spark Fluffy_Pillow 24546.7/63371: 39% mana arcane_charge(4)
2:16.655 aoe n arcane_power Fluffy_Pillow 27588.1/69371: 40% mana arcane_charge(4), combat_meditation
2:16.655 aoe r arcane_barrage Fluffy_Pillow 27588.1/69371: 40% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:17.962 aoe q arcane_explosion Fluffy_Pillow 32176.3/69371: 46% mana arcane_power, rune_of_power, combat_meditation
2:19.269 aoe q arcane_explosion Fluffy_Pillow 31489.7/69371: 45% mana arcane_charge, arcane_power, rune_of_power, combat_meditation
2:20.578 aoe q arcane_explosion Fluffy_Pillow 30805.8/69371: 44% mana arcane_charge(2), arcane_power, rune_of_power, combat_meditation
2:21.883 aoe q arcane_explosion Fluffy_Pillow 30116.4/69371: 43% mana arcane_charge(3), arcane_power, rune_of_power, combat_meditation
2:23.188 aoe r arcane_barrage Fluffy_Pillow 29427.0/69371: 42% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:24.495 aoe p arcane_orb Fluffy_Pillow 34015.2/69371: 49% mana arcane_power, rune_of_power, combat_meditation
2:25.801 aoe r arcane_barrage Fluffy_Pillow 32500.1/63371: 51% mana arcane_charge(4), arcane_power, rune_of_power
2:27.105 aoe q arcane_explosion Fluffy_Pillow 36687.7/63371: 58% mana arcane_power, rune_of_power
2:28.412 aoe q arcane_explosion Fluffy_Pillow 35844.2/63371: 57% mana arcane_charge, arcane_power, rune_of_power
2:29.718 aoe q arcane_explosion Fluffy_Pillow 34999.5/63371: 55% mana arcane_charge(2), arcane_power, rune_of_power
2:31.025 shared_cds t use_mana_gem Kyrian_Pelagos 34156.0/63371: 54% mana arcane_charge(3), arcane_power, rune_of_power
2:31.226 aoe q arcane_explosion Fluffy_Pillow 40747.9/63371: 64% mana arcane_charge(3), arcane_power, rune_of_power
2:32.530 aoe r arcane_barrage Fluffy_Pillow 39900.6/63371: 63% mana arcane_charge(4)
2:33.835 aoe q arcane_explosion Fluffy_Pillow 44089.5/63371: 70% mana
2:35.141 aoe q arcane_explosion Fluffy_Pillow 40744.8/63371: 64% mana arcane_charge
2:36.448 aoe q arcane_explosion Fluffy_Pillow 37401.3/63371: 59% mana arcane_charge(2)
2:37.755 aoe q arcane_explosion Fluffy_Pillow 34057.8/63371: 54% mana arcane_charge(3)
2:39.062 aoe r arcane_barrage Fluffy_Pillow 30714.3/63371: 48% mana arcane_charge(4)
2:40.368 aoe q arcane_explosion Fluffy_Pillow 34904.5/63371: 55% mana
2:41.674 aoe q arcane_explosion Fluffy_Pillow 31559.7/63371: 50% mana arcane_charge, clearcasting
2:42.982 aoe q arcane_explosion Fluffy_Pillow 33217.5/63371: 52% mana arcane_charge(2)
2:44.288 aoe q arcane_explosion Fluffy_Pillow 29872.8/63371: 47% mana arcane_charge(3)
2:45.593 aoe r arcane_barrage Fluffy_Pillow 26526.8/63371: 42% mana arcane_charge(4)
2:46.900 aoe k radiant_spark Fluffy_Pillow 30718.2/63371: 48% mana
2:48.205 aoe m touch_of_the_magi Fluffy_Pillow 31372.2/63371: 50% mana
2:49.510 aoe o rune_of_power Fluffy_Pillow 30526.2/63371: 48% mana arcane_charge(4), clearcasting
2:50.815 aoe r arcane_barrage Fluffy_Pillow 32180.1/63371: 51% mana arcane_charge(4), clearcasting, rune_of_power
2:52.121 aoe p arcane_orb Fluffy_Pillow 36370.3/63371: 57% mana clearcasting, rune_of_power
2:53.427 aoe r arcane_barrage Fluffy_Pillow 37525.5/63371: 59% mana arcane_charge(4), clearcasting, rune_of_power
2:54.732 aoe q arcane_explosion Fluffy_Pillow 41714.4/63371: 66% mana clearcasting, rune_of_power
2:56.038 aoe q arcane_explosion Fluffy_Pillow 43369.6/63371: 68% mana arcane_charge, rune_of_power
2:57.344 aoe q arcane_explosion Fluffy_Pillow 40024.9/63371: 63% mana arcane_charge(2), clearcasting, rune_of_power
2:58.650 aoe q arcane_explosion Fluffy_Pillow 41680.2/63371: 66% mana arcane_charge(3), rune_of_power
2:59.956 aoe r arcane_barrage Fluffy_Pillow 38335.4/63371: 60% mana arcane_charge(4), rune_of_power
3:01.263 aoe q arcane_explosion Fluffy_Pillow 42526.8/63371: 67% mana rune_of_power
3:02.569 aoe q arcane_explosion Fluffy_Pillow 39182.1/63371: 62% mana arcane_charge, clearcasting, rune_of_power
3:03.875 aoe q arcane_explosion Fluffy_Pillow 40837.3/63371: 64% mana arcane_charge(2), rune_of_power
3:05.182 aoe q arcane_explosion Fluffy_Pillow 37493.9/63371: 59% mana arcane_charge(3), rune_of_power
3:06.490 aoe r arcane_barrage Fluffy_Pillow 34151.7/63371: 54% mana arcane_charge(4), clearcasting
3:07.796 aoe q arcane_explosion Fluffy_Pillow 38341.8/63371: 61% mana clearcasting
3:09.102 aoe q arcane_explosion Fluffy_Pillow 39997.0/63371: 63% mana arcane_charge
3:10.410 aoe q arcane_explosion Fluffy_Pillow 36654.8/63371: 58% mana arcane_charge(2)
3:11.717 aoe q arcane_explosion Fluffy_Pillow 33311.4/63371: 53% mana arcane_charge(3)
3:13.022 aoe r arcane_barrage Fluffy_Pillow 29965.4/63371: 47% mana arcane_charge(4), clearcasting
3:14.328 aoe p arcane_orb Fluffy_Pillow 34155.5/63371: 54% mana clearcasting
3:15.634 aoe r arcane_barrage Fluffy_Pillow 35310.7/63371: 56% mana arcane_charge(4), clearcasting
3:16.941 aoe q arcane_explosion Fluffy_Pillow 39502.1/63371: 62% mana clearcasting
3:18.248 aoe j radiant_spark Fluffy_Pillow 41158.7/63371: 65% mana arcane_charge
3:19.555 aoe q arcane_explosion Fluffy_Pillow 45774.2/69371: 66% mana arcane_charge, combat_meditation
3:20.862 aoe q arcane_explosion Fluffy_Pillow 42587.6/69371: 61% mana arcane_charge(2), combat_meditation
3:22.169 aoe q arcane_explosion Fluffy_Pillow 39401.0/69371: 57% mana arcane_charge(3), combat_meditation
3:23.474 aoe r arcane_barrage Fluffy_Pillow 36211.6/69371: 52% mana arcane_charge(4), combat_meditation
3:24.782 aoe q arcane_explosion Fluffy_Pillow 40801.2/69371: 59% mana combat_meditation
3:26.089 aoe q arcane_explosion Fluffy_Pillow 37614.6/69371: 54% mana arcane_charge, combat_meditation
3:27.396 aoe q arcane_explosion Fluffy_Pillow 34427.9/69371: 50% mana arcane_charge(2), combat_meditation
3:28.702 aoe q arcane_explosion Fluffy_Pillow 28537.9/63371: 45% mana arcane_charge(3)
3:30.009 aoe r arcane_barrage Fluffy_Pillow 25194.5/63371: 40% mana arcane_charge(4)
3:31.315 aoe q arcane_explosion Fluffy_Pillow 29384.6/63371: 46% mana
3:32.622 aoe q arcane_explosion Fluffy_Pillow 26041.1/63371: 41% mana arcane_charge
3:33.927 aoe q arcane_explosion Fluffy_Pillow 22695.1/63371: 36% mana arcane_charge(2)
3:35.233 aoe q arcane_explosion Fluffy_Pillow 19350.4/63371: 31% mana arcane_charge(3)
3:36.540 aoe r arcane_barrage Fluffy_Pillow 16006.9/63371: 25% mana arcane_charge(4)
3:37.846 aoe m touch_of_the_magi Fluffy_Pillow 20197.0/63371: 32% mana
3:39.153 aoe o rune_of_power Fluffy_Pillow 19353.6/63371: 31% mana arcane_charge(4)
3:40.460 aoe r arcane_barrage Fluffy_Pillow 21010.1/63371: 33% mana arcane_charge(4), rune_of_power
3:41.767 aoe p arcane_orb Fluffy_Pillow 25201.5/63371: 40% mana rune_of_power
3:43.075 aoe r arcane_barrage Fluffy_Pillow 26359.3/63371: 42% mana arcane_charge(4), rune_of_power
3:44.381 aoe q arcane_explosion Fluffy_Pillow 30549.4/63371: 48% mana rune_of_power
3:45.687 aoe q arcane_explosion Fluffy_Pillow 27204.6/63371: 43% mana arcane_charge, rune_of_power
3:46.994 aoe q arcane_explosion Fluffy_Pillow 23861.2/63371: 38% mana arcane_charge(2), rune_of_power
3:48.301 aoe q arcane_explosion Fluffy_Pillow 20517.7/63371: 32% mana arcane_charge(3), rune_of_power
3:49.608 aoe r arcane_barrage Fluffy_Pillow 17174.2/63371: 27% mana arcane_charge(4), rune_of_power
3:50.913 aoe j radiant_spark Fluffy_Pillow 21363.1/63371: 34% mana rune_of_power
3:52.219 aoe q arcane_explosion Fluffy_Pillow 22018.3/63371: 35% mana rune_of_power
3:53.525 aoe q arcane_explosion Fluffy_Pillow 18673.6/63371: 29% mana arcane_charge, rune_of_power
3:54.833 aoe q arcane_explosion Fluffy_Pillow 15331.4/63371: 24% mana arcane_charge(2), clearcasting, rune_of_power
3:56.139 aoe q arcane_explosion Fluffy_Pillow 16986.7/63371: 27% mana arcane_charge(3)
3:57.445 aoe r arcane_barrage Fluffy_Pillow 13641.9/63371: 22% mana arcane_charge(4)
3:58.753 aoe q arcane_explosion Fluffy_Pillow 17834.6/63371: 28% mana
4:00.058 aoe q arcane_explosion Fluffy_Pillow 14488.6/63371: 23% mana arcane_charge
4:01.366 aoe q arcane_explosion Fluffy_Pillow 11146.4/63371: 18% mana arcane_charge(2)
4:02.671 aoe q arcane_explosion Fluffy_Pillow 7800.4/63371: 12% mana arcane_charge(3)
4:03.978 aoe r arcane_barrage Fluffy_Pillow 4456.9/63371: 7% mana arcane_charge(4)
4:05.283 aoe p arcane_orb Fluffy_Pillow 8645.7/63371: 14% mana
4:06.590 aoe r arcane_barrage Fluffy_Pillow 9802.3/63371: 15% mana arcane_charge(4)
4:07.896 aoe q arcane_explosion Fluffy_Pillow 13992.4/63371: 22% mana
4:09.204 aoe q arcane_explosion Fluffy_Pillow 10650.2/63371: 17% mana arcane_charge
4:10.512 aoe q arcane_explosion Fluffy_Pillow 7308.0/63371: 12% mana arcane_charge(2)
4:11.818 aoe s evocation Kyrian_Pelagos 3963.2/63371: 6% mana arcane_charge(3)
4:16.163 aoe q arcane_explosion Fluffy_Pillow 57809.2/63371: 91% mana arcane_charge(3)
4:17.471 aoe r arcane_barrage Fluffy_Pillow 54467.0/63371: 86% mana arcane_charge(4)
4:18.777 aoe q arcane_explosion Fluffy_Pillow 58657.1/63371: 93% mana
4:20.083 aoe q arcane_explosion Fluffy_Pillow 55312.4/63371: 87% mana arcane_charge, clearcasting
4:21.390 aoe q arcane_explosion Fluffy_Pillow 56968.9/63371: 90% mana arcane_charge(2)
4:22.695 aoe q arcane_explosion Fluffy_Pillow 53622.9/63371: 85% mana arcane_charge(3)
4:24.001 aoe r arcane_barrage Fluffy_Pillow 50278.1/63371: 79% mana arcane_charge(4)
4:25.307 aoe k radiant_spark Fluffy_Pillow 54468.3/63371: 86% mana
4:26.613 aoe m touch_of_the_magi Fluffy_Pillow 60342.6/69371: 87% mana combat_meditation
4:27.919 aoe n arcane_power Fluffy_Pillow 59654.6/69371: 86% mana arcane_charge(4), combat_meditation
4:27.919 shared_cds v berserking Fluffy_Pillow 59654.6/69371: 86% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:27.919 aoe r arcane_barrage Fluffy_Pillow 59654.6/69371: 86% mana berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:29.106 aoe p arcane_orb Fluffy_Pillow 64076.3/69371: 92% mana berserking, arcane_power, rune_of_power, combat_meditation
4:30.294 aoe r arcane_barrage Fluffy_Pillow 65474.6/69371: 94% mana berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:31.483 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana berserking, arcane_power, rune_of_power, combat_meditation
4:32.671 aoe q arcane_explosion Fluffy_Pillow 68519.7/69371: 99% mana berserking, arcane_charge, arcane_power, rune_of_power, combat_meditation
4:33.861 aoe q arcane_explosion Fluffy_Pillow 67670.7/69371: 98% mana berserking, arcane_charge(2), arcane_power, rune_of_power, combat_meditation
4:35.049 aoe q arcane_explosion Fluffy_Pillow 61039.8/63371: 96% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:36.238 aoe r arcane_barrage Fluffy_Pillow 60046.7/63371: 95% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:37.427 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power
4:38.614 aoe q arcane_explosion Fluffy_Pillow 62375.9/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power
4:39.802 aoe q arcane_explosion Fluffy_Pillow 61381.6/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:40.989 aoe q arcane_explosion Fluffy_Pillow 60386.0/63371: 95% mana arcane_charge(3), arcane_power, rune_of_power
4:42.296 aoe r arcane_barrage Fluffy_Pillow 59542.5/63371: 94% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:43.602 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting
4:44.908 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge
4:46.215 aoe q arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge(2)
4:47.522 aoe q arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(3)
4:48.828 shared_cds t use_mana_gem Kyrian_Pelagos 53339.7/63371: 84% mana arcane_charge(4)
4:48.828 aoe o rune_of_power Fluffy_Pillow 59676.9/63371: 94% mana arcane_charge(4)
4:50.134 aoe r arcane_barrage Fluffy_Pillow 61332.2/63371: 97% mana arcane_charge(4), rune_of_power
4:51.440 aoe p arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
4:52.745 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power
4:54.052 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
4:55.358 aoe q arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, clearcasting, rune_of_power
4:56.666 aoe j radiant_spark Fluffy_Pillow 61684.5/63371: 97% mana arcane_charge(2), rune_of_power
4:57.972 aoe q arcane_explosion Fluffy_Pillow 62339.7/63371: 98% mana arcane_charge(2), rune_of_power
4:59.278 aoe q arcane_explosion Fluffy_Pillow 58995.0/63371: 93% mana arcane_charge(3), rune_of_power
5:00.586 aoe r arcane_barrage Fluffy_Pillow 55652.8/63371: 88% mana arcane_charge(4), clearcasting, rune_of_power
5:01.892 aoe q arcane_explosion Fluffy_Pillow 59842.9/63371: 94% mana clearcasting, rune_of_power
5:03.199 aoe q arcane_explosion Fluffy_Pillow 61499.5/63371: 97% mana arcane_charge, rune_of_power
5:04.505 aoe q arcane_explosion Fluffy_Pillow 58154.7/63371: 92% mana arcane_charge(2), clearcasting, rune_of_power
5:05.812 aoe q arcane_explosion Fluffy_Pillow 59811.2/63371: 94% mana arcane_charge(3)
5:07.119 aoe r arcane_barrage Fluffy_Pillow 56467.8/63371: 89% mana arcane_charge(4), clearcasting
5:08.427 aoe q arcane_explosion Fluffy_Pillow 60660.4/63371: 96% mana clearcasting
5:09.732 aoe q arcane_explosion Fluffy_Pillow 62314.4/63371: 98% mana arcane_charge
5:11.037 aoe q arcane_explosion Fluffy_Pillow 58968.4/63371: 93% mana arcane_charge(2)
5:12.345 aoe q arcane_explosion Fluffy_Pillow 55626.2/63371: 88% mana arcane_charge(3)
5:13.652 aoe r arcane_barrage Fluffy_Pillow 52282.7/63371: 83% mana arcane_charge(4), clearcasting
5:14.958 aoe p arcane_orb Fluffy_Pillow 56472.9/63371: 89% mana clearcasting
5:16.266 aoe r arcane_barrage Fluffy_Pillow 57630.7/63371: 91% mana arcane_charge(4), clearcasting
5:17.574 aoe q arcane_explosion Fluffy_Pillow 61823.3/63371: 98% mana clearcasting
5:18.882 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge
5:20.188 aoe q arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge(2), clearcasting
5:21.494 aoe q arcane_explosion Fluffy_Pillow 61682.0/63371: 97% mana arcane_charge(3)
5:22.801 aoe r arcane_barrage Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(4), clearcasting
5:24.110 aoe q arcane_explosion Fluffy_Pillow 62532.4/63371: 99% mana clearcasting
5:25.417 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge
5:26.723 aoe q arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge(2)
5:28.030 aoe q arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(3)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Pelagos"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=328266//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Emeni : 12058 dps, 5299 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
12058.0 12058.0 23.6 / 0.195% 1517.9 / 12.6% 5.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
2174.5 2062.8 Mana 0.00% 49.2 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 12058
Arcane Barrage 3233 26.8% 49.7 5.66sec 19547 15295 Direct 148.8 5464 10972 6524 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.67 148.83 0.00 0.00 1.2780 0.0000 970926.36 970926.36 0.00% 15295.48 15295.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 120.19 89 155 5463.62 1153 31802 5461.91 4819 6222 656536 656536 0.00%
crit 19.25% 28.64 12 49 10971.72 2926 63605 10978.09 7418 16598 314390 314390 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:49.50
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [u]:0.01
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
    rotation
    [x]:0.14
Arcane Blast 3089 25.7% 29.6 8.56sec 31471 29311 Direct 85.7 9132 18286 10890 19.2%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.65 85.68 0.00 0.00 1.0737 0.0000 932968.81 932968.81 0.00% 29310.99 29310.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 69.23 35 90 9132.05 967 13842 9136.57 7463 9862 632182 632182 0.00%
crit 19.19% 16.44 3 30 18285.91 1934 27684 18326.77 12591 24455 300787 300787 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    aoe
    [o]:29.74
  • if_expr:buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
    rotation
    [w]:0.10
Arcane Echo 267 2.2% 37.8 7.39sec 2126 0 Direct 113.4 594 1187 709 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.81 113.42 0.00 0.00 0.0000 0.0000 80369.76 80369.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 91.44 64 120 593.78 443 841 593.09 529 647 54283 54283 0.00%
crit 19.38% 21.97 8 39 1187.50 886 1681 1186.41 933 1494 26087 26087 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 3692 30.6% 129.4 2.12sec 8562 6707 Direct 388.1 2391 4782 2854 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.37 388.11 0.00 0.00 1.2765 0.0000 1107624.69 1107624.69 0.00% 6707.02 6707.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 313.02 251 406 2391.49 1958 4112 2392.17 2327 2465 748474 748474 0.00%
crit 19.35% 75.09 44 110 4782.25 3916 8223 4785.21 4360 5290 359151 359151 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:129.34
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (702) 0.0% (5.8%) 11.5 25.05sec 18294 14288

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.53 0.00 0.00 0.00 1.2805 0.0000 0.00 0.00 0.00% 14287.63 14287.63

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:11.52
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [v]:0.00
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 702 5.8% 34.5 25.02sec 6108 0 Direct 34.5 5120 10219 6109 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.54 34.54 0.00 0.00 0.0000 0.0000 210999.65 210999.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 27.84 18 39 5119.67 3869 8126 5122.75 4192 5566 142479 142479 0.00%
crit 19.42% 6.71 0 16 10218.82 7739 16251 10213.52 0 16251 68520 68520 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (63) 0.0% (0.5%) 13.6 1.83sec 1387 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 63 0.5% 13.6 1.83sec 1387 0 Direct 13.6 1164 2327 1388 19.2%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.57 13.57 0.00 0.00 0.0000 0.0000 18821.34 18821.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 10.96 5 19 1163.53 1164 1164 1163.53 1164 1164 12753 12753 0.00%
crit 19.22% 2.61 0 8 2327.06 2327 2327 2187.73 0 2327 6068 6068 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1727 16.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1729.44 1729.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.20% 0.83 0 1 1480.68 1481 1481 1231.91 0 1481 1232 1232 0.00%
crit 16.80% 0.17 0 1 2961.35 2961 2961 497.53 0 2961 498 498 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (23) 0.0% (0.2%) 1.0 0.00sec 6795 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 170  / 23 0.2% 90.0 1.29sec 75 58 Direct 90.0 63 127 75 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6794.54 6794.54 0.00% 57.69 57.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 72.66 60 83 63.26 43 69 63.26 62 65 4596 4596 0.00%
crit 19.27% 17.34 7 30 126.76 86 139 126.79 111 139 2198 2198 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (981) 0.0% (8.1%) 6.1 52.36sec 48087 38242

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 0.00 0.00 0.00 1.2576 0.0000 0.00 0.00 0.00% 38242.36 38242.36

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.15
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 981 8.1% 6.1 52.25sec 48087 0 Direct 18.3 16119 0 16119 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 18.31 0.00 0.00 0.0000 0.0000 294925.12 294925.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.31 15 21 16119.32 2767 78445 16099.39 10355 21441 294925 294925 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18802.01
  • base_dd_max:18802.01
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Emeni
Arcane Power 2.8 129.42sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.81sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [{]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.8 258.89sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.85
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 2.0 168.23sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 12.13 0.00 4.0097 0.6730 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:2.04
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [z]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.8 257.70sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.80
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
    cooldowns
    [t]:0.00
  • if_expr:debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Rune of Power 6.0 51.15sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.97 0.00 0.00 0.00 1.2562 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.00
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.9 120.74sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [y]:2.95
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.5 160.8 5.9sec 1.4sec 4.5sec 75.66% 0.00% 28.8 (29.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 30.9s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.6s

Stack Uptimes

  • arcane_charge_1:16.80%
  • arcane_charge_2:14.78%
  • arcane_charge_3:14.97%
  • arcane_charge_4:29.10%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.4sec 129.4sec 14.7sec 13.82% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.9s / 134.6s
  • trigger_min/max:121.9s / 134.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.82%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.8sec 258.8sec 11.7sec 7.06% 32.54% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.3s / 263.9s
  • trigger_min/max:253.3s / 263.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.06%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.4 3.4 13.1sec 11.4sec 3.2sec 23.68% 0.00% 1.0 (1.0) 0.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:17.79%
  • clearcasting_2:2.90%
  • clearcasting_3:2.99%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.8 0.0 258.9sec 258.9sec 19.1sec 11.59% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:254.3s / 263.6s
  • trigger_min/max:254.3s / 263.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • deathborne_1:11.59%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 2.0 0.0 174.4sec 174.4sec 4.0sec 2.71% 0.00% 8.1 (8.1) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.0s / 294.2s
  • trigger_min/max:90.0s / 294.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:2.71%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Lead by Example 1.8 0.0 258.9sec 258.9sec 28.1sec 16.94% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:254.3s / 263.6s
  • trigger_min/max:254.3s / 263.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • lead_by_example_1:16.94%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.42% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.42%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.8 0.0 257.3sec 257.3sec 2.2sec 1.32% 17.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:113.2s / 263.1s
  • trigger_min/max:113.2s / 263.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 140.1s

Stack Uptimes

  • presence_of_mind_1:0.62%
  • presence_of_mind_2:0.62%
  • presence_of_mind_3:0.09%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.8 0.0 35.5sec 35.5sec 14.7sec 42.91% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 54.0s
  • trigger_min/max:15.7s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.91%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.03% 0.00% 1.96%
Arcane Barrage Arcane Charge 2 0.09% 0.00% 3.92%
Arcane Barrage Arcane Charge 3 0.16% 0.00% 5.26%
Arcane Barrage Arcane Charge 4 99.72% 89.83% 100.00%
Arcane Blast Arcane Charge 0 1.25% 0.00% 7.14%
Arcane Blast Arcane Charge 1 1.16% 0.00% 6.67%
Arcane Blast Arcane Charge 2 1.03% 0.00% 8.11%
Arcane Blast Arcane Charge 3 0.62% 0.00% 6.67%
Arcane Blast Arcane Charge 4 95.94% 73.33% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 0.50% 0.14% 3.16% 0.7s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.737120.053239.903
Evocation63.8950.000204.194151.72473.092241.131
Rune of Power6.8900.00050.11342.88923.12777.070
Touch of the Magi5.4250.00026.44534.99822.07255.529
Arcane Power6.9181.91814.56319.89011.15526.170
Arcane Barrage3.4640.00328.294174.655135.893210.535
Arcane Orb6.5480.00935.01177.67949.335103.362
Deathborne35.4190.00082.25776.13858.75182.257
Presence of Mind91.1337.898201.278205.11159.275235.691

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
mana_regen Mana 822.88 378254.38 60.98% 459.67 2335.73 0.61%
Evocation Mana 91.10 98450.26 15.87% 1080.65 0.00 0.00%
Mana Gem Mana 2.95 18676.43 3.01% 6337.14 0.00 0.00%
Arcane Barrage Mana 49.65 124884.50 20.13% 2515.06 836.04 0.67%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 2062.76 2174.50 3188.1 29767.8 13.8 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
arcane_blast Mana 29.7 118789.7 4000.3 4007.0 7.9
arcane_explosion Mana 129.3 508790.7 3933.8 3932.8 2.2
arcane_orb Mana 11.5 5513.9 478.3 478.1 38.3
deathborne Mana 1.8 4601.3 2500.0 2503.1 0.0
touch_of_the_magi Mana 6.1 15328.2 2500.0 2499.2 19.2

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Necrolord_Emeni Damage Per Second
Count 1119
Mean 12058.05
Minimum 10787.98
Maximum 13305.79
Spread ( max - min ) 2517.81
Range [ ( max - min ) / 2 * 100% ] 10.44%
Standard Deviation 402.1410
5th Percentile 11403.73
95th Percentile 12736.88
( 95th Percentile - 5th Percentile ) 1333.15
Mean Distribution
Standard Deviation 12.0216
95.00% Confidence Interval ( 12034.49 - 12081.61 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4273
0.1 Scale Factor Error with Delta=300 1381
0.05 Scale Factor Error with Delta=300 5523
0.01 Scale Factor Error with Delta=300 138052
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 1119
Mean 5299.49
Minimum 4683.46
Maximum 5998.90
Spread ( max - min ) 1315.44
Range [ ( max - min ) / 2 * 100% ] 12.41%
Standard Deviation 224.3314
5th Percentile 4935.21
95th Percentile 5678.85
( 95th Percentile - 5th Percentile ) 743.64
Mean Distribution
Standard Deviation 6.7062
95.00% Confidence Interval ( 5286.35 - 5312.63 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 69
0.1% Error 6884
0.1 Scale Factor Error with Delta=300 430
0.05 Scale Factor Error with Delta=300 1719
0.01 Scale Factor Error with Delta=300 42960
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 1119
Mean 12058.05
Minimum 10787.98
Maximum 13305.79
Spread ( max - min ) 2517.81
Range [ ( max - min ) / 2 * 100% ] 10.44%
Damage
Necrolord_Emeni Damage
Count 1119
Mean 3618365.17
Minimum 2707017.78
Maximum 4407165.86
Spread ( max - min ) 1700148.09
Range [ ( max - min ) / 2 * 100% ] 23.49%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.85 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.15 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.00 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.80 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
o 29.74 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 11.52 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 129.34 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 49.50 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 2.04 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
u 0.01 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
v 0.00 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
w 0.10 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
x 0.14 arcane_barrage
actions.shared_cds
# count action,conditions
y 2.95 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
z 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
{ 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklz{oooyooonoooooooooomooorprqqqqrqqqqrqqqqrqsqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrpyrqqqqlrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqskmrprqqqqrqqqqrqqqqrprqqqqryqqqqrqqqqrjkl{oooonooooooooomorprqqqqrqqqqrqqqqrprqqqqrqqsqqrkmrp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.308 aoe k touch_of_the_magi Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, deathborne, lead_by_example
0:02.315 aoe l arcane_power Fluffy_Pillow 59655.3/63371: 94% mana bloodlust, arcane_charge(4), deathborne, lead_by_example
0:02.315 shared_cds z potion Fluffy_Pillow 59655.3/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
0:02.315 shared_cds { berserking Fluffy_Pillow 59655.3/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:02.315 aoe o arcane_blast Fluffy_Pillow 59655.3/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:03.248 aoe o arcane_blast Fluffy_Pillow 57400.3/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:04.181 aoe o arcane_blast Fluffy_Pillow 55145.4/63371: 87% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.112 shared_cds y use_mana_gem Necrolord_Emeni 52887.8/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.112 aoe o arcane_blast Fluffy_Pillow 59225.0/63371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.045 aoe o arcane_blast Fluffy_Pillow 56970.0/63371: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.977 aoe o arcane_blast Fluffy_Pillow 54713.7/63371: 86% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:07.908 aoe n presence_of_mind Fluffy_Pillow 52456.2/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:07.908 aoe o arcane_blast Fluffy_Pillow 52456.2/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:08.823 aoe o arcane_blast Fluffy_Pillow 50178.4/63371: 79% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:09.736 aoe o arcane_blast Fluffy_Pillow 47898.1/63371: 76% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:10.652 aoe o arcane_blast Fluffy_Pillow 45621.5/63371: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:11.585 aoe o arcane_blast Fluffy_Pillow 43366.5/63371: 68% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:12.517 aoe o arcane_blast Fluffy_Pillow 41110.3/63371: 65% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:13.449 aoe o arcane_blast Fluffy_Pillow 38854.0/63371: 61% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:14.382 aoe o arcane_blast Fluffy_Pillow 36599.0/63371: 58% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:15.409 aoe o arcane_blast Fluffy_Pillow 34463.2/63371: 54% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:16.436 aoe o arcane_blast Fluffy_Pillow 32327.3/63371: 51% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:17.463 aoe m rune_of_power Fluffy_Pillow 26754.0/63371: 42% mana bloodlust, arcane_charge(4), clearcasting, deathborne, lead_by_example, potion_of_deathly_fixation
0:18.471 aoe o arcane_blast Fluffy_Pillow 28031.6/63371: 44% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:19.498 aoe o arcane_blast Fluffy_Pillow 22458.2/63371: 35% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:20.527 aoe o arcane_blast Fluffy_Pillow 16887.4/63371: 27% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:21.554 aoe r arcane_barrage Fluffy_Pillow 11314.0/63371: 18% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:22.562 aoe p arcane_orb Fluffy_Pillow 15126.5/63371: 24% mana bloodlust, clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:23.567 aoe r arcane_barrage Fluffy_Pillow 15900.2/63371: 25% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:24.573 aoe q arcane_explosion Fluffy_Pillow 19710.1/63371: 31% mana bloodlust, clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:25.580 aoe q arcane_explosion Fluffy_Pillow 20986.4/63371: 33% mana bloodlust, arcane_charge, clearcasting, rune_of_power, lead_by_example, potion_of_deathly_fixation
0:26.587 aoe q arcane_explosion Fluffy_Pillow 22262.7/63371: 35% mana bloodlust, arcane_charge(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:27.593 aoe q arcane_explosion Fluffy_Pillow 18537.8/63371: 29% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, lead_by_example
0:28.598 aoe r arcane_barrage Fluffy_Pillow 19811.5/63371: 31% mana bloodlust, arcane_charge(4), rune_of_power, lead_by_example
0:29.604 aoe q arcane_explosion Fluffy_Pillow 23621.4/63371: 37% mana bloodlust, rune_of_power, lead_by_example
0:30.610 aoe q arcane_explosion Fluffy_Pillow 19896.4/63371: 31% mana bloodlust, arcane_charge, rune_of_power, lead_by_example
0:31.617 aoe q arcane_explosion Fluffy_Pillow 16172.7/63371: 26% mana bloodlust, arcane_charge(2), rune_of_power
0:32.622 aoe q arcane_explosion Fluffy_Pillow 12446.5/63371: 20% mana bloodlust, arcane_charge(3), rune_of_power
0:33.629 aoe r arcane_barrage Fluffy_Pillow 8722.8/63371: 14% mana bloodlust, arcane_charge(4)
0:34.635 aoe q arcane_explosion Fluffy_Pillow 12532.7/63371: 20% mana bloodlust
0:35.641 aoe q arcane_explosion Fluffy_Pillow 8807.7/63371: 14% mana bloodlust, arcane_charge
0:36.647 aoe q arcane_explosion Fluffy_Pillow 5082.8/63371: 8% mana bloodlust, arcane_charge(2), clearcasting
0:37.653 aoe q arcane_explosion Fluffy_Pillow 6357.8/63371: 10% mana bloodlust, arcane_charge(3)
0:38.658 aoe r arcane_barrage Fluffy_Pillow 2631.6/63371: 4% mana bloodlust, arcane_charge(4)
0:39.665 aoe q arcane_explosion Fluffy_Pillow 6442.7/63371: 10% mana bloodlust
0:40.672 aoe s evocation Necrolord_Emeni 2719.0/63371: 4% mana bloodlust, arcane_charge
0:44.015 aoe q arcane_explosion Fluffy_Pillow 56587.2/63371: 89% mana arcane_charge
0:45.321 aoe q arcane_explosion Fluffy_Pillow 53242.5/63371: 84% mana arcane_charge(2)
0:46.627 aoe q arcane_explosion Fluffy_Pillow 49897.8/63371: 79% mana arcane_charge(3)
0:47.934 aoe r arcane_barrage Fluffy_Pillow 46554.3/63371: 73% mana arcane_charge(4)
0:49.240 aoe p arcane_orb Fluffy_Pillow 50744.4/63371: 80% mana
0:50.547 aoe r arcane_barrage Fluffy_Pillow 51900.9/63371: 82% mana arcane_charge(4)
0:51.854 aoe q arcane_explosion Fluffy_Pillow 56092.3/63371: 89% mana
0:53.161 aoe q arcane_explosion Fluffy_Pillow 52748.8/63371: 83% mana arcane_charge
0:54.469 aoe q arcane_explosion Fluffy_Pillow 49406.6/63371: 78% mana arcane_charge(2), clearcasting
0:55.776 aoe q arcane_explosion Fluffy_Pillow 51063.2/63371: 81% mana arcane_charge(3)
0:57.083 aoe r arcane_barrage Fluffy_Pillow 47719.7/63371: 75% mana arcane_charge(4)
0:58.390 aoe q arcane_explosion Fluffy_Pillow 51911.1/63371: 82% mana
0:59.698 aoe q arcane_explosion Fluffy_Pillow 48568.9/63371: 77% mana arcane_charge
1:01.005 aoe q arcane_explosion Fluffy_Pillow 45225.4/63371: 71% mana arcane_charge(2)
1:02.312 aoe q arcane_explosion Fluffy_Pillow 41881.9/63371: 66% mana arcane_charge(3)
1:03.618 aoe r arcane_barrage Fluffy_Pillow 38537.2/63371: 61% mana arcane_charge(4)
1:04.925 aoe k touch_of_the_magi Fluffy_Pillow 42728.6/63371: 67% mana
1:06.230 aoe m rune_of_power Fluffy_Pillow 41882.6/63371: 66% mana arcane_charge(4)
1:07.536 aoe r arcane_barrage Fluffy_Pillow 43537.8/63371: 69% mana arcane_charge(4), rune_of_power
1:08.844 aoe q arcane_explosion Fluffy_Pillow 47730.5/63371: 75% mana rune_of_power
1:10.150 aoe q arcane_explosion Fluffy_Pillow 44385.8/63371: 70% mana arcane_charge, rune_of_power
1:11.457 aoe q arcane_explosion Fluffy_Pillow 41042.3/63371: 65% mana arcane_charge(2), rune_of_power
1:12.764 aoe q arcane_explosion Fluffy_Pillow 37698.8/63371: 59% mana arcane_charge(3), clearcasting, rune_of_power
1:14.070 aoe r arcane_barrage Fluffy_Pillow 39354.1/63371: 62% mana arcane_charge(4), rune_of_power
1:15.377 aoe p arcane_orb Fluffy_Pillow 43545.5/63371: 69% mana rune_of_power
1:16.684 aoe r arcane_barrage Fluffy_Pillow 44702.0/63371: 71% mana arcane_charge(4), rune_of_power
1:17.991 aoe q arcane_explosion Fluffy_Pillow 48893.4/63371: 77% mana rune_of_power
1:19.296 aoe q arcane_explosion Fluffy_Pillow 45547.4/63371: 72% mana arcane_charge, clearcasting, rune_of_power
1:20.603 aoe q arcane_explosion Fluffy_Pillow 47203.9/63371: 74% mana arcane_charge(2), rune_of_power
1:21.911 aoe q arcane_explosion Fluffy_Pillow 43861.7/63371: 69% mana arcane_charge(3), rune_of_power
1:23.217 aoe r arcane_barrage Fluffy_Pillow 40517.0/63371: 64% mana arcane_charge(4)
1:24.524 aoe q arcane_explosion Fluffy_Pillow 44708.4/63371: 71% mana
1:25.832 aoe q arcane_explosion Fluffy_Pillow 41366.1/63371: 65% mana arcane_charge
1:27.139 aoe q arcane_explosion Fluffy_Pillow 38022.7/63371: 60% mana arcane_charge(2)
1:28.447 aoe q arcane_explosion Fluffy_Pillow 34680.5/63371: 55% mana arcane_charge(3)
1:29.754 aoe r arcane_barrage Fluffy_Pillow 31337.0/63371: 49% mana arcane_charge(4), clearcasting
1:31.061 aoe q arcane_explosion Fluffy_Pillow 35528.4/63371: 56% mana clearcasting
1:32.370 aoe q arcane_explosion Fluffy_Pillow 37187.5/63371: 59% mana arcane_charge
1:33.678 aoe q arcane_explosion Fluffy_Pillow 33845.3/63371: 53% mana arcane_charge(2), clearcasting
1:34.983 aoe q arcane_explosion Fluffy_Pillow 35499.2/63371: 56% mana arcane_charge(3)
1:36.289 aoe r arcane_barrage Fluffy_Pillow 32154.5/63371: 51% mana arcane_charge(4)
1:37.595 aoe p arcane_orb Fluffy_Pillow 36344.6/63371: 57% mana
1:38.901 aoe r arcane_barrage Fluffy_Pillow 37499.9/63371: 59% mana arcane_charge(4)
1:40.209 aoe q arcane_explosion Fluffy_Pillow 41692.5/63371: 66% mana
1:41.515 aoe q arcane_explosion Fluffy_Pillow 38347.8/63371: 61% mana arcane_charge
1:42.821 aoe q arcane_explosion Fluffy_Pillow 35003.1/63371: 55% mana arcane_charge(2)
1:44.128 aoe q arcane_explosion Fluffy_Pillow 31659.6/63371: 50% mana arcane_charge(3)
1:45.436 aoe r arcane_barrage Fluffy_Pillow 28317.4/63371: 45% mana arcane_charge(4)
1:46.742 aoe q arcane_explosion Fluffy_Pillow 32507.5/63371: 51% mana
1:48.049 aoe q arcane_explosion Fluffy_Pillow 29164.0/63371: 46% mana arcane_charge
1:49.355 aoe q arcane_explosion Fluffy_Pillow 25819.3/63371: 41% mana arcane_charge(2)
1:50.662 aoe q arcane_explosion Fluffy_Pillow 22475.8/63371: 35% mana arcane_charge(3)
1:51.968 aoe r arcane_barrage Fluffy_Pillow 19131.1/63371: 30% mana arcane_charge(4)
1:53.275 aoe k touch_of_the_magi Fluffy_Pillow 23322.5/63371: 37% mana
1:54.582 aoe m rune_of_power Fluffy_Pillow 22479.0/63371: 35% mana arcane_charge(4)
1:55.890 aoe r arcane_barrage Fluffy_Pillow 24136.8/63371: 38% mana arcane_charge(4), rune_of_power
1:57.197 aoe q arcane_explosion Fluffy_Pillow 28328.2/63371: 45% mana rune_of_power
1:58.503 aoe q arcane_explosion Fluffy_Pillow 24983.5/63371: 39% mana arcane_charge, rune_of_power
1:59.810 aoe q arcane_explosion Fluffy_Pillow 21640.0/63371: 34% mana arcane_charge(2), rune_of_power
2:01.117 aoe q arcane_explosion Fluffy_Pillow 18296.5/63371: 29% mana arcane_charge(3), rune_of_power
2:02.424 aoe r arcane_barrage Fluffy_Pillow 14953.0/63371: 24% mana arcane_charge(4), rune_of_power
2:03.731 aoe p arcane_orb Fluffy_Pillow 19144.4/63371: 30% mana rune_of_power
2:05.039 shared_cds y use_mana_gem Necrolord_Emeni 20302.2/63371: 32% mana arcane_charge(4), clearcasting, rune_of_power
2:05.112 aoe r arcane_barrage Fluffy_Pillow 26731.9/63371: 42% mana arcane_charge(4), clearcasting, rune_of_power
2:06.418 aoe q arcane_explosion Fluffy_Pillow 30922.0/63371: 49% mana clearcasting, rune_of_power
2:07.726 aoe q arcane_explosion Fluffy_Pillow 32579.8/63371: 51% mana arcane_charge, rune_of_power
2:09.031 aoe q arcane_explosion Fluffy_Pillow 29233.8/63371: 46% mana arcane_charge(2), rune_of_power
2:10.335 aoe q arcane_explosion Fluffy_Pillow 25886.5/63371: 41% mana arcane_charge(3), rune_of_power
2:11.640 aoe l arcane_power Fluffy_Pillow 22540.5/63371: 36% mana arcane_charge(4)
2:11.640 aoe r arcane_barrage Fluffy_Pillow 22540.5/63371: 36% mana arcane_charge(4), arcane_power, rune_of_power
2:12.946 aoe q arcane_explosion Fluffy_Pillow 26730.6/63371: 42% mana arcane_power, rune_of_power
2:14.252 aoe q arcane_explosion Fluffy_Pillow 25885.9/63371: 41% mana arcane_charge, arcane_power, rune_of_power
2:15.558 aoe q arcane_explosion Fluffy_Pillow 25041.2/63371: 40% mana arcane_charge(2), arcane_power, rune_of_power
2:16.865 aoe q arcane_explosion Fluffy_Pillow 24197.7/63371: 38% mana arcane_charge(3), arcane_power, rune_of_power
2:18.172 aoe r arcane_barrage Fluffy_Pillow 23354.2/63371: 37% mana arcane_charge(4), arcane_power, rune_of_power
2:19.479 aoe q arcane_explosion Fluffy_Pillow 27545.6/63371: 43% mana arcane_power, rune_of_power
2:20.786 aoe q arcane_explosion Fluffy_Pillow 26702.1/63371: 42% mana arcane_charge, arcane_power, rune_of_power
2:22.092 aoe q arcane_explosion Fluffy_Pillow 25857.4/63371: 41% mana arcane_charge(2), arcane_power, rune_of_power
2:23.397 aoe q arcane_explosion Fluffy_Pillow 25011.4/63371: 39% mana arcane_charge(3), arcane_power, rune_of_power
2:24.703 aoe r arcane_barrage Fluffy_Pillow 24166.7/63371: 38% mana arcane_charge(4), arcane_power, rune_of_power
2:26.011 aoe p arcane_orb Fluffy_Pillow 28359.3/63371: 45% mana arcane_power, rune_of_power
2:27.318 aoe r arcane_barrage Fluffy_Pillow 29765.8/63371: 47% mana arcane_charge(4)
2:28.623 aoe q arcane_explosion Fluffy_Pillow 33954.7/63371: 54% mana
2:29.932 aoe q arcane_explosion Fluffy_Pillow 30613.7/63371: 48% mana arcane_charge, clearcasting
2:31.238 aoe q arcane_explosion Fluffy_Pillow 32269.0/63371: 51% mana arcane_charge(2)
2:32.544 aoe q arcane_explosion Fluffy_Pillow 28924.3/63371: 46% mana arcane_charge(3)
2:33.852 aoe r arcane_barrage Fluffy_Pillow 25582.1/63371: 40% mana arcane_charge(4)
2:35.159 aoe q arcane_explosion Fluffy_Pillow 29773.5/63371: 47% mana
2:36.465 aoe q arcane_explosion Fluffy_Pillow 26428.7/63371: 42% mana arcane_charge
2:37.771 aoe q arcane_explosion Fluffy_Pillow 23084.0/63371: 36% mana arcane_charge(2)
2:39.078 aoe q arcane_explosion Fluffy_Pillow 19740.5/63371: 31% mana arcane_charge(3)
2:40.384 aoe r arcane_barrage Fluffy_Pillow 16395.8/63371: 26% mana arcane_charge(4), clearcasting
2:41.692 aoe k touch_of_the_magi Fluffy_Pillow 20588.4/63371: 32% mana clearcasting
2:42.998 aoe m rune_of_power Fluffy_Pillow 19743.7/63371: 31% mana arcane_charge(4), clearcasting
2:44.303 aoe r arcane_barrage Fluffy_Pillow 21397.7/63371: 34% mana arcane_charge(4), clearcasting, rune_of_power
2:45.609 aoe q arcane_explosion Fluffy_Pillow 25587.8/63371: 40% mana clearcasting, rune_of_power
2:46.916 aoe q arcane_explosion Fluffy_Pillow 27244.3/63371: 43% mana arcane_charge, rune_of_power
2:48.222 aoe q arcane_explosion Fluffy_Pillow 23899.6/63371: 38% mana arcane_charge(2), clearcasting, rune_of_power
2:49.528 aoe q arcane_explosion Fluffy_Pillow 25554.9/63371: 40% mana arcane_charge(3), rune_of_power
2:50.835 aoe r arcane_barrage Fluffy_Pillow 22211.4/63371: 35% mana arcane_charge(4), rune_of_power
2:52.142 aoe p arcane_orb Fluffy_Pillow 26402.8/63371: 42% mana rune_of_power
2:53.448 aoe r arcane_barrage Fluffy_Pillow 27558.0/63371: 43% mana arcane_charge(4), rune_of_power
2:54.755 aoe q arcane_explosion Fluffy_Pillow 31749.4/63371: 50% mana rune_of_power
2:56.059 aoe q arcane_explosion Fluffy_Pillow 28402.1/63371: 45% mana arcane_charge, rune_of_power
2:57.365 aoe q arcane_explosion Fluffy_Pillow 25057.4/63371: 40% mana arcane_charge(2), rune_of_power
2:58.673 aoe q arcane_explosion Fluffy_Pillow 21715.2/63371: 34% mana arcane_charge(3), clearcasting, rune_of_power
2:59.979 aoe r arcane_barrage Fluffy_Pillow 23370.5/63371: 37% mana arcane_charge(4)
3:01.286 aoe q arcane_explosion Fluffy_Pillow 27561.8/63371: 43% mana
3:02.592 aoe q arcane_explosion Fluffy_Pillow 24217.1/63371: 38% mana arcane_charge
3:03.899 aoe q arcane_explosion Fluffy_Pillow 20873.6/63371: 33% mana arcane_charge(2)
3:05.205 aoe q arcane_explosion Fluffy_Pillow 17528.9/63371: 28% mana arcane_charge(3), clearcasting
3:06.513 aoe r arcane_barrage Fluffy_Pillow 19186.7/63371: 30% mana arcane_charge(4)
3:07.822 aoe q arcane_explosion Fluffy_Pillow 23380.6/63371: 37% mana
3:09.129 aoe q arcane_explosion Fluffy_Pillow 20037.1/63371: 32% mana arcane_charge
3:10.435 aoe q arcane_explosion Fluffy_Pillow 16692.4/63371: 26% mana arcane_charge(2)
3:11.741 aoe q arcane_explosion Fluffy_Pillow 13347.7/63371: 21% mana arcane_charge(3)
3:13.047 aoe r arcane_barrage Fluffy_Pillow 10002.9/63371: 16% mana arcane_charge(4)
3:14.353 aoe p arcane_orb Fluffy_Pillow 14193.0/63371: 22% mana
3:15.660 aoe r arcane_barrage Fluffy_Pillow 15349.6/63371: 24% mana arcane_charge(4)
3:16.967 aoe q arcane_explosion Fluffy_Pillow 19541.0/63371: 31% mana
3:18.273 aoe q arcane_explosion Fluffy_Pillow 16196.2/63371: 26% mana arcane_charge
3:19.580 aoe q arcane_explosion Fluffy_Pillow 12852.8/63371: 20% mana arcane_charge(2)
3:20.886 aoe q arcane_explosion Fluffy_Pillow 9508.0/63371: 15% mana arcane_charge(3)
3:22.192 aoe r arcane_barrage Fluffy_Pillow 6163.3/63371: 10% mana arcane_charge(4)
3:23.499 aoe q arcane_explosion Fluffy_Pillow 10354.7/63371: 16% mana
3:24.807 aoe q arcane_explosion Fluffy_Pillow 7012.5/63371: 11% mana arcane_charge
3:26.112 aoe s evocation Fluffy_Pillow 3666.5/63371: 6% mana arcane_charge(2)
3:30.456 aoe k touch_of_the_magi Fluffy_Pillow 57511.1/63371: 91% mana arcane_charge(2)
3:31.763 aoe m rune_of_power Fluffy_Pillow 56667.7/63371: 89% mana arcane_charge(4)
3:33.069 aoe r arcane_barrage Fluffy_Pillow 58322.9/63371: 92% mana arcane_charge(4), rune_of_power
3:34.375 aoe p arcane_orb Fluffy_Pillow 62513.0/63371: 99% mana rune_of_power
3:35.682 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power
3:36.987 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
3:38.293 aoe q arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power
3:39.598 aoe q arcane_explosion Fluffy_Pillow 56680.7/63371: 89% mana arcane_charge(2), rune_of_power
3:40.905 aoe q arcane_explosion Fluffy_Pillow 53337.2/63371: 84% mana arcane_charge(3), clearcasting, rune_of_power
3:42.210 aoe r arcane_barrage Fluffy_Pillow 54991.2/63371: 87% mana arcane_charge(4), rune_of_power
3:43.518 aoe q arcane_explosion Fluffy_Pillow 59183.9/63371: 93% mana rune_of_power
3:44.825 aoe q arcane_explosion Fluffy_Pillow 55840.4/63371: 88% mana arcane_charge, rune_of_power
3:46.132 aoe q arcane_explosion Fluffy_Pillow 52496.9/63371: 83% mana arcane_charge(2), clearcasting, rune_of_power
3:47.439 aoe q arcane_explosion Fluffy_Pillow 54153.4/63371: 85% mana arcane_charge(3), rune_of_power
3:48.745 aoe r arcane_barrage Fluffy_Pillow 50808.7/63371: 80% mana arcane_charge(4)
3:50.051 aoe q arcane_explosion Fluffy_Pillow 54998.8/63371: 87% mana
3:51.357 aoe q arcane_explosion Fluffy_Pillow 51654.1/63371: 82% mana arcane_charge, clearcasting
3:52.664 aoe q arcane_explosion Fluffy_Pillow 53310.6/63371: 84% mana arcane_charge(2)
3:53.970 aoe q arcane_explosion Fluffy_Pillow 49965.9/63371: 79% mana arcane_charge(3)
3:55.277 aoe r arcane_barrage Fluffy_Pillow 46622.4/63371: 74% mana arcane_charge(4)
3:56.584 aoe p arcane_orb Fluffy_Pillow 50813.8/63371: 80% mana
3:57.890 aoe r arcane_barrage Fluffy_Pillow 51969.1/63371: 82% mana arcane_charge(4)
3:59.197 aoe q arcane_explosion Fluffy_Pillow 56160.4/63371: 89% mana
4:00.503 aoe q arcane_explosion Fluffy_Pillow 52815.7/63371: 83% mana arcane_charge
4:01.811 aoe q arcane_explosion Fluffy_Pillow 49473.5/63371: 78% mana arcane_charge(2)
4:03.116 aoe q arcane_explosion Fluffy_Pillow 46127.5/63371: 73% mana arcane_charge(3)
4:04.424 aoe r arcane_barrage Fluffy_Pillow 42785.3/63371: 68% mana arcane_charge(4)
4:05.731 shared_cds y use_mana_gem Necrolord_Emeni 46976.7/63371: 74% mana
4:05.731 aoe q arcane_explosion Fluffy_Pillow 53313.8/63371: 84% mana
4:07.036 aoe q arcane_explosion Fluffy_Pillow 49967.8/63371: 79% mana arcane_charge
4:08.342 aoe q arcane_explosion Fluffy_Pillow 46623.1/63371: 74% mana arcane_charge(2)
4:09.647 aoe q arcane_explosion Fluffy_Pillow 43277.1/63371: 68% mana arcane_charge(3)
4:10.952 aoe r arcane_barrage Fluffy_Pillow 39931.1/63371: 63% mana arcane_charge(4)
4:12.258 aoe q arcane_explosion Fluffy_Pillow 44121.2/63371: 70% mana
4:13.565 aoe q arcane_explosion Fluffy_Pillow 40777.7/63371: 64% mana arcane_charge
4:14.872 aoe q arcane_explosion Fluffy_Pillow 37434.2/63371: 59% mana arcane_charge(2)
4:16.177 aoe q arcane_explosion Fluffy_Pillow 34088.2/63371: 54% mana arcane_charge(3)
4:17.484 aoe r arcane_barrage Fluffy_Pillow 30744.8/63371: 49% mana arcane_charge(4)
4:18.790 aoe j deathborne Fluffy_Pillow 34934.9/63371: 55% mana
4:20.096 aoe k touch_of_the_magi Fluffy_Pillow 34090.1/63371: 54% mana deathborne, lead_by_example
4:21.402 aoe l arcane_power Fluffy_Pillow 33245.4/63371: 52% mana arcane_charge(4), deathborne, lead_by_example
4:21.402 shared_cds { berserking Fluffy_Pillow 33245.4/63371: 52% mana arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:21.402 aoe o arcane_blast Fluffy_Pillow 33245.4/63371: 52% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:22.613 aoe o arcane_blast Fluffy_Pillow 31342.8/63371: 49% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:23.822 aoe o arcane_blast Fluffy_Pillow 29437.6/63371: 46% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:25.033 aoe o arcane_blast Fluffy_Pillow 27534.9/63371: 43% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:26.244 aoe n presence_of_mind Fluffy_Pillow 25632.3/63371: 40% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:26.244 aoe o arcane_blast Fluffy_Pillow 25632.3/63371: 40% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:27.433 aoe o arcane_blast Fluffy_Pillow 23701.8/63371: 37% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(2), rune_of_power, deathborne, lead_by_example
4:28.621 aoe o arcane_blast Fluffy_Pillow 21770.0/63371: 34% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind, rune_of_power, deathborne, lead_by_example
4:29.811 aoe o arcane_blast Fluffy_Pillow 19840.7/63371: 31% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:31.023 aoe o arcane_blast Fluffy_Pillow 17939.3/63371: 28% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:32.233 aoe o arcane_blast Fluffy_Pillow 16035.4/63371: 25% mana berserking, arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, deathborne, lead_by_example
4:33.444 aoe o arcane_blast Fluffy_Pillow 14132.8/63371: 22% mana arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, lead_by_example
4:34.779 aoe o arcane_blast Fluffy_Pillow 12387.3/63371: 20% mana arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, lead_by_example
4:36.112 aoe o arcane_blast Fluffy_Pillow 10639.3/63371: 17% mana arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, deathborne, lead_by_example
4:37.443 aoe m rune_of_power Fluffy_Pillow 5451.2/63371: 9% mana arcane_charge(4), clearcasting(3), deathborne, lead_by_example
4:38.749 aoe o arcane_blast Fluffy_Pillow 7106.5/63371: 11% mana arcane_charge(4), clearcasting(3), rune_of_power, deathborne, lead_by_example
4:40.081 aoe r arcane_barrage Fluffy_Pillow 1919.7/63371: 3% mana arcane_charge(4), clearcasting(3), rune_of_power, deathborne, lead_by_example
4:41.388 aoe p arcane_orb Fluffy_Pillow 6111.1/63371: 10% mana clearcasting(3), rune_of_power, lead_by_example
4:42.696 aoe r arcane_barrage Fluffy_Pillow 7268.9/63371: 11% mana arcane_charge(4), clearcasting(3), rune_of_power, lead_by_example
4:44.002 aoe q arcane_explosion Fluffy_Pillow 11459.0/63371: 18% mana clearcasting(3), rune_of_power, lead_by_example
4:45.308 aoe q arcane_explosion Fluffy_Pillow 13114.3/63371: 21% mana arcane_charge, clearcasting(2), rune_of_power, lead_by_example
4:46.616 aoe q arcane_explosion Fluffy_Pillow 14772.1/63371: 23% mana arcane_charge(2), clearcasting, rune_of_power, lead_by_example
4:47.924 aoe q arcane_explosion Fluffy_Pillow 16429.9/63371: 26% mana arcane_charge(3), rune_of_power, lead_by_example
4:49.231 aoe r arcane_barrage Fluffy_Pillow 13086.4/63371: 21% mana arcane_charge(4), rune_of_power, lead_by_example
4:50.540 aoe q arcane_explosion Fluffy_Pillow 17280.3/63371: 27% mana rune_of_power
4:51.845 aoe q arcane_explosion Fluffy_Pillow 13934.3/63371: 22% mana arcane_charge, clearcasting, rune_of_power
4:53.152 aoe q arcane_explosion Fluffy_Pillow 15590.8/63371: 25% mana arcane_charge(2), rune_of_power
4:54.457 aoe q arcane_explosion Fluffy_Pillow 12244.8/63371: 19% mana arcane_charge(3)
4:55.764 aoe r arcane_barrage Fluffy_Pillow 8901.4/63371: 14% mana arcane_charge(4)
4:57.071 aoe q arcane_explosion Fluffy_Pillow 13092.7/63371: 21% mana
4:58.377 aoe q arcane_explosion Fluffy_Pillow 9748.0/63371: 15% mana arcane_charge
4:59.683 aoe q arcane_explosion Fluffy_Pillow 6403.3/63371: 10% mana arcane_charge(2)
5:00.990 aoe q arcane_explosion Fluffy_Pillow 3059.8/63371: 5% mana arcane_charge(3), clearcasting
5:02.296 aoe r arcane_barrage Fluffy_Pillow 4715.1/63371: 7% mana arcane_charge(4)
5:03.604 aoe p arcane_orb Fluffy_Pillow 8907.7/63371: 14% mana
5:04.912 aoe r arcane_barrage Fluffy_Pillow 10065.5/63371: 16% mana arcane_charge(4)
5:06.220 aoe q arcane_explosion Fluffy_Pillow 14258.2/63371: 22% mana
5:07.527 aoe q arcane_explosion Fluffy_Pillow 10914.7/63371: 17% mana arcane_charge
5:08.834 aoe q arcane_explosion Fluffy_Pillow 7571.2/63371: 12% mana arcane_charge(2)
5:10.140 aoe q arcane_explosion Fluffy_Pillow 4226.5/63371: 7% mana arcane_charge(3), clearcasting
5:11.445 aoe r arcane_barrage Fluffy_Pillow 5880.5/63371: 9% mana arcane_charge(4)
5:12.751 aoe q arcane_explosion Fluffy_Pillow 10070.6/63371: 16% mana
5:14.057 aoe q arcane_explosion Fluffy_Pillow 6725.9/63371: 11% mana arcane_charge
5:15.364 aoe s evocation Fluffy_Pillow 3382.4/63371: 5% mana arcane_charge(2)
5:19.709 aoe q arcane_explosion Fluffy_Pillow 57228.3/63371: 90% mana arcane_charge(2)
5:21.016 aoe q arcane_explosion Fluffy_Pillow 53884.9/63371: 85% mana arcane_charge(3)
5:22.324 aoe r arcane_barrage Fluffy_Pillow 50542.7/63371: 80% mana arcane_charge(4), clearcasting
5:23.632 aoe k touch_of_the_magi Fluffy_Pillow 54735.3/63371: 86% mana clearcasting
5:24.939 aoe m rune_of_power Fluffy_Pillow 53891.8/63371: 85% mana arcane_charge(4), clearcasting
5:26.245 aoe r arcane_barrage Fluffy_Pillow 55547.1/63371: 88% mana arcane_charge(4), clearcasting, rune_of_power
5:27.549 aoe p arcane_orb Fluffy_Pillow 59734.7/63371: 94% mana clearcasting, rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Emeni"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=342156//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Marileth : 11453 dps, 5019 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11452.5 11452.5 20.2 / 0.177% 1269.1 / 11.1% 5.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2173.3 2062.1 Mana 0.00% 49.2 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Marileth 11453
Arcane Barrage 3176 27.7% 49.7 5.65sec 19182 15011 Direct 148.9 5359 10729 6401 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.68 148.86 0.00 0.00 1.2779 0.0000 953033.53 953033.53 0.00% 15011.00 15011.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 119.94 90 154 5359.05 1153 27654 5363.00 4731 6239 642740 642740 0.00%
crit 19.43% 28.92 11 48 10728.88 2926 55308 10730.82 6992 15466 310293 310293 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:49.52
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [u]:0.00
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
    rotation
    [x]:0.15
Arcane Blast 2697 23.7% 29.7 8.38sec 27444 25575 Direct 85.8 7953 15905 9497 19.4%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.69 85.81 0.00 0.00 1.0731 0.0000 814798.60 814798.60 0.00% 25575.15 25575.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 69.16 33 94 7953.03 841 12036 7957.47 6744 8665 550077 550077 0.00%
crit 19.39% 16.64 5 33 15904.89 1682 24073 15936.98 11428 22038 264722 264722 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    aoe
    [o]:29.78
  • if_expr:buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
    rotation
    [w]:0.09
Arcane Echo 248 2.2% 37.8 7.38sec 1976 0 Direct 113.3 552 1105 659 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.77 113.32 0.00 0.00 0.0000 0.0000 74657.95 74657.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 91.41 63 122 552.20 443 731 551.53 505 589 50466 50466 0.00%
crit 19.33% 21.91 8 42 1104.66 886 1462 1104.62 918 1357 24192 24192 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 3652 31.8% 129.4 2.12sec 8468 6634 Direct 388.1 2365 4725 2823 19.4%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.37 388.12 0.00 0.00 1.2764 0.0000 1095471.38 1095471.38 0.00% 6633.99 6633.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 312.80 247 394 2364.66 1958 4112 2365.75 2289 2434 739625 739625 0.00%
crit 19.41% 75.32 45 113 4725.09 3916 8223 4727.87 4329 5161 355847 355847 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:129.34
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (686) 0.0% (6.0%) 11.5 24.94sec 17841 13933

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.54 0.00 0.00 0.00 1.2805 0.0000 0.00 0.00 0.00% 13932.70 13932.70

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:11.53
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [v]:0.01
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 686 6.0% 34.6 24.95sec 5956 0 Direct 34.6 5004 10013 5956 19.0%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.58 34.58 0.00 0.00 0.0000 0.0000 205939.19 205939.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.97% 28.00 17 41 5003.97 3869 8126 5010.08 4430 5436 140055 140055 0.00%
crit 19.03% 6.58 0 15 10012.77 7739 16251 10014.20 0 14446 65884 65884 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (64) 0.0% (0.6%) 13.6 1.78sec 1392 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 64 0.6% 13.6 1.78sec 1392 0 Direct 13.6 1164 2327 1393 19.7%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.60 13.60 0.00 0.00 0.0000 0.0000 18935.72 18935.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.34% 10.93 4 18 1163.53 1164 1164 1163.53 1164 1164 12714 12714 0.00%
crit 19.66% 2.67 0 9 2327.06 2327 2327 2185.65 0 2327 6222 6222 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1762 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1765.17 1765.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 0.81 0 1 1480.68 1481 1481 1196.19 0 1481 1196 1196 0.00%
crit 19.21% 0.19 0 1 2961.35 2961 2961 568.98 0 2961 569 569 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6033 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6033.16 6033.16 0.00% 51.22 51.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 72.70 58 84 56.22 43 60 56.22 55 57 4087 4087 0.00%
crit 19.22% 17.30 6 32 112.48 86 120 112.47 98 120 1946 1946 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (903) 0.0% (7.9%) 6.1 52.37sec 44265 35202

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 0.00 0.00 0.00 1.2575 0.0000 0.00 0.00 0.00% 35202.24 35202.24

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.15
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 903 7.9% 6.1 52.26sec 44265 0 Direct 18.3 14824 0 14824 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 18.29 0.00 0.00 0.0000 0.0000 271127.65 271127.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.29 15 21 14823.68 2506 67963 14822.54 10060 19549 271128 271128 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17239.32
  • base_dd_max:17239.32
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Marileth
Arcane Power 2.8 129.34sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.83
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.63sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [{]:1.83
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.8 258.76sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.85
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 2.0 175.89sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 12.11 0.00 4.0186 0.6738 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:2.04
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [z]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.8 257.44sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.80
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
    cooldowns
    [t]:0.00
  • if_expr:debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Rune of Power 6.0 51.06sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.97 0.00 0.00 0.00 1.2562 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.99
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.9 120.84sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [y]:2.95
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.4 160.9 5.9sec 1.4sec 4.5sec 75.65% 0.00% 28.9 (29.1) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 30.9s
  • trigger_min/max:0.0s / 8.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.6s

Stack Uptimes

  • arcane_charge_1:16.82%
  • arcane_charge_2:14.77%
  • arcane_charge_3:14.91%
  • arcane_charge_4:29.15%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.4sec 129.4sec 14.7sec 13.82% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.5s / 139.5s
  • trigger_min/max:121.5s / 139.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.82%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.6sec 258.6sec 11.7sec 7.06% 32.50% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.3s / 266.1s
  • trigger_min/max:253.3s / 266.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.06%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.6 3.5 13.0sec 11.3sec 3.2sec 23.86% 0.00% 1.1 (1.1) 0.3

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:17.89%
  • clearcasting_2:2.94%
  • clearcasting_3:3.04%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.8 0.0 258.7sec 258.7sec 19.2sec 11.59% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:254.3s / 265.8s
  • trigger_min/max:254.3s / 265.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • deathborne_1:11.59%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 2.0 0.0 172.2sec 172.2sec 4.0sec 2.70% 0.00% 8.1 (8.1) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.0s / 289.3s
  • trigger_min/max:90.0s / 289.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:2.70%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.42% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.42%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.8 0.0 257.1sec 257.1sec 2.2sec 1.33% 17.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:113.2s / 265.3s
  • trigger_min/max:113.2s / 265.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 143.9s

Stack Uptimes

  • presence_of_mind_1:0.61%
  • presence_of_mind_2:0.62%
  • presence_of_mind_3:0.09%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.8 0.0 35.4sec 35.4sec 14.7sec 42.93% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 53.3s
  • trigger_min/max:15.7s / 53.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.93%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.03% 0.00% 3.51%
Arcane Barrage Arcane Charge 2 0.09% 0.00% 7.02%
Arcane Barrage Arcane Charge 3 0.16% 0.00% 5.77%
Arcane Barrage Arcane Charge 4 99.72% 90.74% 100.00%
Arcane Blast Arcane Charge 0 1.22% 0.00% 7.14%
Arcane Blast Arcane Charge 1 1.04% 0.00% 8.57%
Arcane Blast Arcane Charge 2 0.94% 0.00% 6.67%
Arcane Blast Arcane Charge 3 0.58% 0.00% 6.67%
Arcane Blast Arcane Charge 4 96.23% 73.33% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 0.50% 0.14% 3.11% 0.7s 0.0s 3.9s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.737120.053239.903
Evocation62.9760.000199.293152.44072.786234.927
Rune of Power6.8500.00050.11042.72423.11477.352
Touch of the Magi5.3850.00026.45834.88521.80774.819
Arcane Power6.8641.50919.49419.7608.32428.380
Arcane Barrage3.4690.00228.292174.670133.570211.500
Arcane Orb6.5410.00035.00877.52551.550100.141
Deathborne35.3210.00084.46776.04658.75184.467
Presence of Mind91.1947.900203.489204.94259.273235.696

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Marileth
mana_regen Mana 822.81 378253.44 61.00% 459.71 2331.93 0.61%
Evocation Mana 91.02 98249.05 15.85% 1079.43 0.00 0.00%
Mana Gem Mana 2.95 18665.26 3.01% 6337.14 0.00 0.00%
Arcane Barrage Mana 49.67 124879.34 20.14% 2514.25 874.70 0.70%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 2062.06 2173.29 3215.9 29922.1 23.1 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Marileth
arcane_blast Mana 29.7 119218.6 4008.9 4015.5 6.8
arcane_explosion Mana 129.3 508026.4 3927.8 3926.9 2.2
arcane_orb Mana 11.5 5518.3 478.3 478.0 37.3
deathborne Mana 1.8 4596.9 2500.0 2503.1 0.0
touch_of_the_magi Mana 6.1 15308.4 2500.0 2499.3 17.7

Statistics & Data Analysis

Fight Length
Necrolord_Marileth Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Necrolord_Marileth Damage Per Second
Count 1119
Mean 11452.53
Minimum 10444.88
Maximum 12426.90
Spread ( max - min ) 1982.02
Range [ ( max - min ) / 2 * 100% ] 8.65%
Standard Deviation 345.5588
5th Percentile 10914.52
95th Percentile 12043.61
( 95th Percentile - 5th Percentile ) 1129.09
Mean Distribution
Standard Deviation 10.3302
95.00% Confidence Interval ( 11432.28 - 11472.78 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3498
0.1 Scale Factor Error with Delta=300 1020
0.05 Scale Factor Error with Delta=300 4078
0.01 Scale Factor Error with Delta=300 101936
Priority Target DPS
Necrolord_Marileth Priority Target Damage Per Second
Count 1119
Mean 5019.07
Minimum 4470.54
Maximum 5613.76
Spread ( max - min ) 1143.22
Range [ ( max - min ) / 2 * 100% ] 11.39%
Standard Deviation 195.7225
5th Percentile 4708.74
95th Percentile 5366.63
( 95th Percentile - 5th Percentile ) 657.88
Mean Distribution
Standard Deviation 5.8509
95.00% Confidence Interval ( 5007.61 - 5030.54 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5842
0.1 Scale Factor Error with Delta=300 328
0.05 Scale Factor Error with Delta=300 1309
0.01 Scale Factor Error with Delta=300 32702
DPS(e)
Necrolord_Marileth Damage Per Second (Effective)
Count 1119
Mean 11452.53
Minimum 10444.88
Maximum 12426.90
Spread ( max - min ) 1982.02
Range [ ( max - min ) / 2 * 100% ] 8.65%
Damage
Necrolord_Marileth Damage
Count 1119
Mean 3435729.18
Minimum 2582652.88
Maximum 4163140.48
Spread ( max - min ) 1580487.59
Range [ ( max - min ) / 2 * 100% ] 23.00%
DTPS
Necrolord_Marileth Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Marileth Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Marileth Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Marileth Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Marileth Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Marileth Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_MarilethTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Marileth Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.85 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.15 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.83 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.99 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.80 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
o 29.78 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 11.53 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 129.34 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 49.52 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 2.04 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
u 0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
v 0.01 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
w 0.09 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
x 0.15 arcane_barrage
actions.shared_cds
# count action,conditions
y 2.95 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
z 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
{ 1.83 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklz{oooyooonoooooooooomooorprqqqqrqqqsqrqqqqrprqqqqrqqqqrqqqqrkmrprqqqqrqqqqrqqqqrprqqqqrqqqqrqqqqrkmrprqqqqyrqqqqlrqqqqrprqqqqrqqqqrqqqqrkmrprqqqqrqqqqrqqqqrprqqqqrqqqqrqqqqrkmrprqqqqrqqqqrqqsqqrprqqqyqrqqqqrkjl{ooonoooooooooomoorprqqqqrqqqqrqqqqrprqqqqrqqqqrqqkmrprq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Marileth 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Marileth 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, deathborne
0:02.313 aoe l arcane_power Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), deathborne
0:02.313 shared_cds z potion Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne
0:02.313 shared_cds { berserking Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:02.313 aoe o arcane_blast Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:03.244 aoe o arcane_blast Fluffy_Pillow 57395.3/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:04.177 aoe o arcane_blast Fluffy_Pillow 55140.3/63371: 87% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.109 shared_cds y use_mana_gem Necrolord_Marileth 52884.0/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.109 aoe o arcane_blast Fluffy_Pillow 59221.2/63371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.042 aoe o arcane_blast Fluffy_Pillow 56966.2/63371: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.974 aoe o arcane_blast Fluffy_Pillow 54709.9/63371: 86% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:07.907 aoe n presence_of_mind Fluffy_Pillow 52454.9/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:07.907 aoe o arcane_blast Fluffy_Pillow 52454.9/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:08.823 aoe o arcane_blast Fluffy_Pillow 50178.4/63371: 79% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, deathborne, potion_of_deathly_fixation
0:09.736 aoe o arcane_blast Fluffy_Pillow 47898.1/63371: 76% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, deathborne, potion_of_deathly_fixation
0:10.649 aoe o arcane_blast Fluffy_Pillow 45617.7/63371: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:11.582 aoe o arcane_blast Fluffy_Pillow 43362.7/63371: 68% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:12.516 aoe o arcane_blast Fluffy_Pillow 41109.0/63371: 65% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:13.449 aoe o arcane_blast Fluffy_Pillow 38854.0/63371: 61% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:14.381 aoe o arcane_blast Fluffy_Pillow 36597.8/63371: 58% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:15.407 aoe o arcane_blast Fluffy_Pillow 34460.7/63371: 54% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:16.434 aoe o arcane_blast Fluffy_Pillow 32324.8/63371: 51% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:17.459 aoe m rune_of_power Fluffy_Pillow 26748.9/63371: 42% mana bloodlust, arcane_charge(4), deathborne, potion_of_deathly_fixation
0:18.465 aoe o arcane_blast Fluffy_Pillow 28023.9/63371: 44% mana bloodlust, arcane_charge(4), rune_of_power, deathborne, potion_of_deathly_fixation
0:19.492 aoe o arcane_blast Fluffy_Pillow 22450.6/63371: 35% mana bloodlust, arcane_charge(4), rune_of_power, deathborne, potion_of_deathly_fixation
0:20.519 aoe o arcane_blast Fluffy_Pillow 16877.2/63371: 27% mana bloodlust, arcane_charge(4), rune_of_power, deathborne, potion_of_deathly_fixation
0:21.548 aoe r arcane_barrage Fluffy_Pillow 11306.4/63371: 18% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:22.553 aoe p arcane_orb Fluffy_Pillow 15115.1/63371: 24% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:23.558 aoe r arcane_barrage Fluffy_Pillow 15888.8/63371: 25% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.563 aoe q arcane_explosion Fluffy_Pillow 19697.4/63371: 31% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.572 aoe q arcane_explosion Fluffy_Pillow 15976.3/63371: 25% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:26.581 aoe q arcane_explosion Fluffy_Pillow 12255.1/63371: 19% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.587 aoe q arcane_explosion Fluffy_Pillow 13530.1/63371: 21% mana bloodlust, arcane_charge(3), rune_of_power
0:28.594 aoe r arcane_barrage Fluffy_Pillow 9806.4/63371: 15% mana bloodlust, arcane_charge(4), rune_of_power
0:29.600 aoe q arcane_explosion Fluffy_Pillow 13616.3/63371: 21% mana bloodlust, rune_of_power
0:30.608 aoe q arcane_explosion Fluffy_Pillow 9893.9/63371: 16% mana bloodlust, arcane_charge, rune_of_power
0:31.615 aoe q arcane_explosion Fluffy_Pillow 6170.2/63371: 10% mana bloodlust, arcane_charge(2), rune_of_power
0:32.620 aoe s evocation Necrolord_Marileth 2444.0/63371: 4% mana bloodlust, arcane_charge(3), rune_of_power
0:35.964 aoe q arcane_explosion Fluffy_Pillow 56313.4/63371: 89% mana bloodlust, arcane_charge(3)
0:36.969 aoe r arcane_barrage Fluffy_Pillow 52587.2/63371: 83% mana bloodlust, arcane_charge(4), clearcasting
0:37.975 aoe q arcane_explosion Fluffy_Pillow 56397.1/63371: 89% mana bloodlust, clearcasting
0:38.982 aoe q arcane_explosion Fluffy_Pillow 57673.4/63371: 91% mana bloodlust, arcane_charge
0:39.988 aoe q arcane_explosion Fluffy_Pillow 53948.4/63371: 85% mana bloodlust, arcane_charge(2)
0:40.993 aoe q arcane_explosion Fluffy_Pillow 50222.2/63371: 79% mana bloodlust, arcane_charge(3)
0:42.000 aoe r arcane_barrage Fluffy_Pillow 46498.5/63371: 73% mana arcane_charge(4)
0:43.305 aoe p arcane_orb Fluffy_Pillow 50687.4/63371: 80% mana
0:44.611 aoe r arcane_barrage Fluffy_Pillow 51842.6/63371: 82% mana arcane_charge(4)
0:45.918 aoe q arcane_explosion Fluffy_Pillow 56034.0/63371: 88% mana
0:47.224 aoe q arcane_explosion Fluffy_Pillow 52689.3/63371: 83% mana arcane_charge
0:48.530 aoe q arcane_explosion Fluffy_Pillow 49344.5/63371: 78% mana arcane_charge(2)
0:49.835 aoe q arcane_explosion Fluffy_Pillow 45998.5/63371: 73% mana arcane_charge(3)
0:51.141 aoe r arcane_barrage Fluffy_Pillow 42653.8/63371: 67% mana arcane_charge(4)
0:52.447 aoe q arcane_explosion Fluffy_Pillow 46843.9/63371: 74% mana
0:53.754 aoe q arcane_explosion Fluffy_Pillow 43500.4/63371: 69% mana arcane_charge
0:55.061 aoe q arcane_explosion Fluffy_Pillow 40157.0/63371: 63% mana arcane_charge(2)
0:56.367 aoe q arcane_explosion Fluffy_Pillow 36812.2/63371: 58% mana arcane_charge(3)
0:57.674 aoe r arcane_barrage Fluffy_Pillow 33468.8/63371: 53% mana arcane_charge(4)
0:58.981 aoe q arcane_explosion Fluffy_Pillow 37660.1/63371: 59% mana
1:00.287 aoe q arcane_explosion Fluffy_Pillow 34315.4/63371: 54% mana arcane_charge
1:01.595 aoe q arcane_explosion Fluffy_Pillow 30973.2/63371: 49% mana arcane_charge(2), clearcasting
1:02.901 aoe q arcane_explosion Fluffy_Pillow 32628.5/63371: 51% mana arcane_charge(3)
1:04.207 aoe r arcane_barrage Fluffy_Pillow 29283.7/63371: 46% mana arcane_charge(4)
1:05.512 aoe k touch_of_the_magi Fluffy_Pillow 33472.6/63371: 53% mana
1:06.819 aoe m rune_of_power Fluffy_Pillow 32629.1/63371: 51% mana arcane_charge(4)
1:08.125 aoe r arcane_barrage Fluffy_Pillow 34284.4/63371: 54% mana arcane_charge(4), rune_of_power
1:09.432 aoe p arcane_orb Fluffy_Pillow 38475.7/63371: 61% mana rune_of_power
1:10.739 aoe r arcane_barrage Fluffy_Pillow 39632.3/63371: 63% mana arcane_charge(4), rune_of_power
1:12.046 aoe q arcane_explosion Fluffy_Pillow 43823.7/63371: 69% mana rune_of_power
1:13.352 aoe q arcane_explosion Fluffy_Pillow 40478.9/63371: 64% mana arcane_charge, clearcasting, rune_of_power
1:14.658 aoe q arcane_explosion Fluffy_Pillow 42134.2/63371: 66% mana arcane_charge(2), rune_of_power
1:15.965 aoe q arcane_explosion Fluffy_Pillow 38790.7/63371: 61% mana arcane_charge(3), clearcasting, rune_of_power
1:17.271 aoe r arcane_barrage Fluffy_Pillow 40446.0/63371: 64% mana arcane_charge(4), rune_of_power
1:18.576 aoe q arcane_explosion Fluffy_Pillow 44634.8/63371: 70% mana rune_of_power
1:19.883 aoe q arcane_explosion Fluffy_Pillow 41291.4/63371: 65% mana arcane_charge, rune_of_power
1:21.190 aoe q arcane_explosion Fluffy_Pillow 37947.9/63371: 60% mana arcane_charge(2), clearcasting, rune_of_power
1:22.496 aoe q arcane_explosion Fluffy_Pillow 39603.1/63371: 62% mana arcane_charge(3), rune_of_power
1:23.802 aoe r arcane_barrage Fluffy_Pillow 36258.4/63371: 57% mana arcane_charge(4)
1:25.108 aoe q arcane_explosion Fluffy_Pillow 40448.5/63371: 64% mana
1:26.414 aoe q arcane_explosion Fluffy_Pillow 37103.8/63371: 59% mana arcane_charge
1:27.721 aoe q arcane_explosion Fluffy_Pillow 33760.3/63371: 53% mana arcane_charge(2)
1:29.028 aoe q arcane_explosion Fluffy_Pillow 30416.9/63371: 48% mana arcane_charge(3)
1:30.334 aoe r arcane_barrage Fluffy_Pillow 27072.1/63371: 43% mana arcane_charge(4)
1:31.642 aoe p arcane_orb Fluffy_Pillow 31264.8/63371: 49% mana
1:32.950 aoe r arcane_barrage Fluffy_Pillow 32422.6/63371: 51% mana arcane_charge(4), clearcasting
1:34.256 aoe q arcane_explosion Fluffy_Pillow 36612.7/63371: 58% mana clearcasting
1:35.563 aoe q arcane_explosion Fluffy_Pillow 38269.2/63371: 60% mana arcane_charge
1:36.870 aoe q arcane_explosion Fluffy_Pillow 34925.7/63371: 55% mana arcane_charge(2), clearcasting
1:38.176 aoe q arcane_explosion Fluffy_Pillow 36581.0/63371: 58% mana arcane_charge(3)
1:39.485 aoe r arcane_barrage Fluffy_Pillow 33240.1/63371: 52% mana arcane_charge(4), clearcasting
1:40.792 aoe q arcane_explosion Fluffy_Pillow 37431.5/63371: 59% mana clearcasting
1:42.098 aoe q arcane_explosion Fluffy_Pillow 39086.7/63371: 62% mana arcane_charge
1:43.404 aoe q arcane_explosion Fluffy_Pillow 35742.0/63371: 56% mana arcane_charge(2)
1:44.711 aoe q arcane_explosion Fluffy_Pillow 32398.5/63371: 51% mana arcane_charge(3)
1:46.016 aoe r arcane_barrage Fluffy_Pillow 29052.5/63371: 46% mana arcane_charge(4)
1:47.321 aoe q arcane_explosion Fluffy_Pillow 33241.3/63371: 52% mana
1:48.627 aoe q arcane_explosion Fluffy_Pillow 29896.6/63371: 47% mana arcane_charge, clearcasting
1:49.933 aoe q arcane_explosion Fluffy_Pillow 31551.9/63371: 50% mana arcane_charge(2)
1:51.238 aoe q arcane_explosion Fluffy_Pillow 28205.9/63371: 45% mana arcane_charge(3)
1:52.544 aoe r arcane_barrage Fluffy_Pillow 24861.1/63371: 39% mana arcane_charge(4)
1:53.850 aoe k touch_of_the_magi Fluffy_Pillow 29051.2/63371: 46% mana
1:55.157 aoe m rune_of_power Fluffy_Pillow 28207.8/63371: 45% mana arcane_charge(4)
1:56.463 aoe r arcane_barrage Fluffy_Pillow 29863.0/63371: 47% mana arcane_charge(4), rune_of_power
1:57.770 aoe p arcane_orb Fluffy_Pillow 34054.4/63371: 54% mana rune_of_power
1:59.078 aoe r arcane_barrage Fluffy_Pillow 35212.2/63371: 56% mana arcane_charge(4), rune_of_power
2:00.385 aoe q arcane_explosion Fluffy_Pillow 39403.6/63371: 62% mana rune_of_power
2:01.691 aoe q arcane_explosion Fluffy_Pillow 36058.9/63371: 57% mana arcane_charge, rune_of_power
2:02.997 aoe q arcane_explosion Fluffy_Pillow 32714.1/63371: 52% mana arcane_charge(2), rune_of_power
2:04.303 aoe q arcane_explosion Fluffy_Pillow 29369.4/63371: 46% mana arcane_charge(3), rune_of_power
2:05.610 shared_cds y use_mana_gem Necrolord_Marileth 26025.9/63371: 41% mana arcane_charge(4), rune_of_power
2:05.610 aoe r arcane_barrage Fluffy_Pillow 32363.1/63371: 51% mana arcane_charge(4), rune_of_power
2:06.915 aoe q arcane_explosion Fluffy_Pillow 36551.9/63371: 58% mana rune_of_power
2:08.221 aoe q arcane_explosion Fluffy_Pillow 33207.2/63371: 52% mana arcane_charge, rune_of_power
2:09.527 aoe q arcane_explosion Fluffy_Pillow 29862.4/63371: 47% mana arcane_charge(2), rune_of_power
2:10.833 aoe q arcane_explosion Fluffy_Pillow 26517.7/63371: 42% mana arcane_charge(3), rune_of_power
2:12.138 aoe l arcane_power Fluffy_Pillow 23171.7/63371: 37% mana arcane_charge(4)
2:12.138 aoe r arcane_barrage Fluffy_Pillow 23171.7/63371: 37% mana arcane_charge(4), arcane_power, rune_of_power
2:13.443 aoe q arcane_explosion Fluffy_Pillow 27360.5/63371: 43% mana arcane_power, rune_of_power
2:14.750 aoe q arcane_explosion Fluffy_Pillow 26517.1/63371: 42% mana arcane_charge, arcane_power, clearcasting, rune_of_power
2:16.055 aoe q arcane_explosion Fluffy_Pillow 28171.1/63371: 44% mana arcane_charge(2), arcane_power, rune_of_power
2:17.361 aoe q arcane_explosion Fluffy_Pillow 27326.3/63371: 43% mana arcane_charge(3), arcane_power, rune_of_power
2:18.667 aoe r arcane_barrage Fluffy_Pillow 26481.6/63371: 42% mana arcane_charge(4), arcane_power, rune_of_power
2:19.974 aoe p arcane_orb Fluffy_Pillow 30673.0/63371: 48% mana arcane_power, rune_of_power
2:21.280 aoe r arcane_barrage Fluffy_Pillow 32078.2/63371: 51% mana arcane_charge(4), arcane_power, rune_of_power
2:22.588 aoe q arcane_explosion Fluffy_Pillow 36270.9/63371: 57% mana arcane_power, rune_of_power
2:23.895 aoe q arcane_explosion Fluffy_Pillow 35427.4/63371: 56% mana arcane_charge, arcane_power, rune_of_power
2:25.203 aoe q arcane_explosion Fluffy_Pillow 34585.2/63371: 55% mana arcane_charge(2), arcane_power, rune_of_power
2:26.509 aoe q arcane_explosion Fluffy_Pillow 33740.5/63371: 53% mana arcane_charge(3), arcane_power, rune_of_power
2:27.816 aoe r arcane_barrage Fluffy_Pillow 32897.0/63371: 52% mana arcane_charge(4)
2:29.122 aoe q arcane_explosion Fluffy_Pillow 37087.1/63371: 59% mana
2:30.428 aoe q arcane_explosion Fluffy_Pillow 33742.4/63371: 53% mana arcane_charge
2:31.735 aoe q arcane_explosion Fluffy_Pillow 30398.9/63371: 48% mana arcane_charge(2)
2:33.043 aoe q arcane_explosion Fluffy_Pillow 27056.7/63371: 43% mana arcane_charge(3)
2:34.350 aoe r arcane_barrage Fluffy_Pillow 23713.2/63371: 37% mana arcane_charge(4)
2:35.658 aoe q arcane_explosion Fluffy_Pillow 27905.9/63371: 44% mana
2:36.964 aoe q arcane_explosion Fluffy_Pillow 24561.2/63371: 39% mana arcane_charge
2:38.270 aoe q arcane_explosion Fluffy_Pillow 21216.4/63371: 33% mana arcane_charge(2)
2:39.577 aoe q arcane_explosion Fluffy_Pillow 17873.0/63371: 28% mana arcane_charge(3)
2:40.884 aoe r arcane_barrage Fluffy_Pillow 14529.5/63371: 23% mana arcane_charge(4), clearcasting
2:42.192 aoe k touch_of_the_magi Fluffy_Pillow 18722.1/63371: 30% mana clearcasting
2:43.498 aoe m rune_of_power Fluffy_Pillow 17877.4/63371: 28% mana arcane_charge(4), clearcasting
2:44.803 aoe r arcane_barrage Fluffy_Pillow 19531.4/63371: 31% mana arcane_charge(4), clearcasting, rune_of_power
2:46.108 aoe p arcane_orb Fluffy_Pillow 23720.2/63371: 37% mana clearcasting, rune_of_power
2:47.415 aoe r arcane_barrage Fluffy_Pillow 24876.8/63371: 39% mana arcane_charge(4), clearcasting, rune_of_power
2:48.722 aoe q arcane_explosion Fluffy_Pillow 29068.2/63371: 46% mana clearcasting, rune_of_power
2:50.031 aoe q arcane_explosion Fluffy_Pillow 30727.2/63371: 48% mana arcane_charge, rune_of_power
2:51.338 aoe q arcane_explosion Fluffy_Pillow 27383.8/63371: 43% mana arcane_charge(2), rune_of_power
2:52.645 aoe q arcane_explosion Fluffy_Pillow 24040.3/63371: 38% mana arcane_charge(3), rune_of_power
2:53.954 aoe r arcane_barrage Fluffy_Pillow 20699.3/63371: 33% mana arcane_charge(4), rune_of_power
2:55.260 aoe q arcane_explosion Fluffy_Pillow 24889.5/63371: 39% mana rune_of_power
2:56.567 aoe q arcane_explosion Fluffy_Pillow 21546.0/63371: 34% mana arcane_charge, rune_of_power
2:57.874 aoe q arcane_explosion Fluffy_Pillow 18202.5/63371: 29% mana arcane_charge(2), rune_of_power
2:59.182 aoe q arcane_explosion Fluffy_Pillow 14860.3/63371: 23% mana arcane_charge(3), rune_of_power
3:00.488 aoe r arcane_barrage Fluffy_Pillow 11515.6/63371: 18% mana arcane_charge(4)
3:01.795 aoe q arcane_explosion Fluffy_Pillow 15707.0/63371: 25% mana
3:03.101 aoe q arcane_explosion Fluffy_Pillow 12362.2/63371: 20% mana arcane_charge, clearcasting
3:04.407 aoe q arcane_explosion Fluffy_Pillow 14017.5/63371: 22% mana arcane_charge(2)
3:05.714 aoe q arcane_explosion Fluffy_Pillow 10674.0/63371: 17% mana arcane_charge(3)
3:07.020 aoe r arcane_barrage Fluffy_Pillow 7329.3/63371: 12% mana arcane_charge(4), clearcasting
3:08.328 aoe p arcane_orb Fluffy_Pillow 11521.9/63371: 18% mana clearcasting
3:09.635 aoe r arcane_barrage Fluffy_Pillow 12678.5/63371: 20% mana arcane_charge(4), clearcasting
3:10.942 aoe q arcane_explosion Fluffy_Pillow 16869.9/63371: 27% mana clearcasting
3:12.247 aoe q arcane_explosion Fluffy_Pillow 18523.8/63371: 29% mana arcane_charge
3:13.552 aoe q arcane_explosion Fluffy_Pillow 15177.8/63371: 24% mana arcane_charge(2)
3:14.858 aoe q arcane_explosion Fluffy_Pillow 11833.1/63371: 19% mana arcane_charge(3), clearcasting
3:16.163 aoe r arcane_barrage Fluffy_Pillow 13487.1/63371: 21% mana arcane_charge(4)
3:17.471 aoe q arcane_explosion Fluffy_Pillow 17679.7/63371: 28% mana
3:18.778 aoe q arcane_explosion Fluffy_Pillow 14336.3/63371: 23% mana arcane_charge, clearcasting
3:20.085 aoe q arcane_explosion Fluffy_Pillow 15992.8/63371: 25% mana arcane_charge(2)
3:21.392 aoe q arcane_explosion Fluffy_Pillow 12649.3/63371: 20% mana arcane_charge(3)
3:22.699 aoe r arcane_barrage Fluffy_Pillow 9305.9/63371: 15% mana arcane_charge(4), clearcasting
3:24.005 aoe q arcane_explosion Fluffy_Pillow 13496.0/63371: 21% mana clearcasting
3:25.311 aoe q arcane_explosion Fluffy_Pillow 15151.2/63371: 24% mana arcane_charge
3:26.618 aoe q arcane_explosion Fluffy_Pillow 11807.8/63371: 19% mana arcane_charge(2)
3:27.927 aoe q arcane_explosion Fluffy_Pillow 8466.8/63371: 13% mana arcane_charge(3)
3:29.232 aoe r arcane_barrage Fluffy_Pillow 5120.8/63371: 8% mana arcane_charge(4), clearcasting
3:30.539 aoe k touch_of_the_magi Fluffy_Pillow 9312.2/63371: 15% mana clearcasting
3:31.846 aoe m rune_of_power Fluffy_Pillow 8468.7/63371: 13% mana arcane_charge(4), clearcasting
3:33.152 aoe r arcane_barrage Fluffy_Pillow 10124.0/63371: 16% mana arcane_charge(4), clearcasting, rune_of_power
3:34.457 aoe p arcane_orb Fluffy_Pillow 14312.9/63371: 23% mana clearcasting, rune_of_power
3:35.765 aoe r arcane_barrage Fluffy_Pillow 15470.7/63371: 24% mana arcane_charge(4), clearcasting, rune_of_power
3:37.070 aoe q arcane_explosion Fluffy_Pillow 19659.5/63371: 31% mana clearcasting, rune_of_power
3:38.378 aoe q arcane_explosion Fluffy_Pillow 21317.3/63371: 34% mana arcane_charge, rune_of_power
3:39.684 aoe q arcane_explosion Fluffy_Pillow 17972.6/63371: 28% mana arcane_charge(2), rune_of_power
3:40.989 aoe q arcane_explosion Fluffy_Pillow 14626.6/63371: 23% mana arcane_charge(3), rune_of_power
3:42.296 aoe r arcane_barrage Fluffy_Pillow 11283.1/63371: 18% mana arcane_charge(4), rune_of_power
3:43.599 aoe q arcane_explosion Fluffy_Pillow 15469.4/63371: 24% mana rune_of_power
3:44.907 aoe q arcane_explosion Fluffy_Pillow 12127.2/63371: 19% mana arcane_charge, rune_of_power
3:46.215 aoe q arcane_explosion Fluffy_Pillow 8785.0/63371: 14% mana arcane_charge(2), rune_of_power
3:47.520 aoe q arcane_explosion Fluffy_Pillow 5439.0/63371: 9% mana arcane_charge(3), clearcasting, rune_of_power
3:48.826 aoe r arcane_barrage Fluffy_Pillow 7094.3/63371: 11% mana arcane_charge(4)
3:50.134 aoe q arcane_explosion Fluffy_Pillow 11286.9/63371: 18% mana
3:51.439 aoe q arcane_explosion Fluffy_Pillow 7940.9/63371: 13% mana arcane_charge
3:52.745 aoe s evocation Fluffy_Pillow 4596.2/63371: 7% mana arcane_charge(2)
3:57.090 aoe q arcane_explosion Fluffy_Pillow 58442.1/63371: 92% mana arcane_charge(2)
3:58.396 aoe q arcane_explosion Fluffy_Pillow 55097.4/63371: 87% mana arcane_charge(3)
3:59.703 aoe r arcane_barrage Fluffy_Pillow 51753.9/63371: 82% mana arcane_charge(4)
4:01.009 aoe p arcane_orb Fluffy_Pillow 55944.0/63371: 88% mana
4:02.315 aoe r arcane_barrage Fluffy_Pillow 57099.3/63371: 90% mana arcane_charge(4)
4:03.622 aoe q arcane_explosion Fluffy_Pillow 61290.7/63371: 97% mana
4:04.932 aoe q arcane_explosion Fluffy_Pillow 57951.0/63371: 91% mana arcane_charge
4:06.239 aoe q arcane_explosion Fluffy_Pillow 54607.5/63371: 86% mana arcane_charge(2)
4:07.546 shared_cds y use_mana_gem Necrolord_Marileth 51264.0/63371: 81% mana arcane_charge(3)
4:07.546 aoe q arcane_explosion Fluffy_Pillow 57601.2/63371: 91% mana arcane_charge(3)
4:08.853 aoe r arcane_barrage Fluffy_Pillow 54257.7/63371: 86% mana arcane_charge(4)
4:10.160 aoe q arcane_explosion Fluffy_Pillow 58449.1/63371: 92% mana
4:11.465 aoe q arcane_explosion Fluffy_Pillow 55103.1/63371: 87% mana arcane_charge
4:12.771 aoe q arcane_explosion Fluffy_Pillow 51758.4/63371: 82% mana arcane_charge(2), clearcasting
4:14.077 aoe q arcane_explosion Fluffy_Pillow 53413.6/63371: 84% mana arcane_charge(3)
4:15.383 aoe r arcane_barrage Fluffy_Pillow 50068.9/63371: 79% mana arcane_charge(4)
4:16.689 aoe k touch_of_the_magi Fluffy_Pillow 54259.0/63371: 86% mana
4:18.148 aoe j deathborne Fluffy_Pillow 53608.2/63371: 85% mana arcane_charge(4)
4:19.455 aoe l arcane_power Fluffy_Pillow 52764.7/63371: 83% mana arcane_charge(4), deathborne
4:19.455 shared_cds { berserking Fluffy_Pillow 52764.7/63371: 83% mana arcane_charge(4), arcane_power, rune_of_power, deathborne
4:19.455 aoe o arcane_blast Fluffy_Pillow 52764.7/63371: 83% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:20.666 aoe o arcane_blast Fluffy_Pillow 50862.1/63371: 80% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:21.878 aoe o arcane_blast Fluffy_Pillow 48960.7/63371: 77% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:23.088 aoe n presence_of_mind Fluffy_Pillow 47056.8/63371: 74% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:23.088 aoe o arcane_blast Fluffy_Pillow 47056.8/63371: 74% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:24.276 aoe o arcane_blast Fluffy_Pillow 45125.0/63371: 71% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, deathborne
4:25.464 aoe o arcane_blast Fluffy_Pillow 43193.2/63371: 68% mana berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, deathborne
4:26.653 aoe o arcane_blast Fluffy_Pillow 41262.7/63371: 65% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:27.864 aoe o arcane_blast Fluffy_Pillow 39360.0/63371: 62% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:29.075 aoe o arcane_blast Fluffy_Pillow 37457.4/63371: 59% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:30.286 aoe o arcane_blast Fluffy_Pillow 35554.7/63371: 56% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:31.497 aoe o arcane_blast Fluffy_Pillow 33652.1/63371: 53% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:32.830 aoe o arcane_blast Fluffy_Pillow 31904.1/63371: 50% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:34.163 aoe o arcane_blast Fluffy_Pillow 30156.1/63371: 48% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:35.496 aoe m rune_of_power Fluffy_Pillow 24970.5/63371: 39% mana arcane_charge(4), clearcasting, deathborne
4:36.802 aoe o arcane_blast Fluffy_Pillow 26625.8/63371: 42% mana arcane_charge(4), clearcasting(2), rune_of_power, deathborne
4:38.136 aoe o arcane_blast Fluffy_Pillow 21441.5/63371: 34% mana arcane_charge(4), clearcasting(2), rune_of_power, deathborne
4:39.469 aoe r arcane_barrage Fluffy_Pillow 16256.0/63371: 26% mana arcane_charge(4), clearcasting(2), rune_of_power
4:40.775 aoe p arcane_orb Fluffy_Pillow 20446.1/63371: 32% mana clearcasting(2), rune_of_power
4:42.079 aoe r arcane_barrage Fluffy_Pillow 21598.9/63371: 34% mana arcane_charge(4), clearcasting(2), rune_of_power
4:43.387 aoe q arcane_explosion Fluffy_Pillow 25791.5/63371: 41% mana clearcasting(2), rune_of_power
4:44.691 aoe q arcane_explosion Fluffy_Pillow 27444.3/63371: 43% mana arcane_charge, clearcasting, rune_of_power
4:45.998 aoe q arcane_explosion Fluffy_Pillow 29100.8/63371: 46% mana arcane_charge(2), rune_of_power
4:47.304 aoe q arcane_explosion Fluffy_Pillow 25756.0/63371: 41% mana arcane_charge(3), rune_of_power
4:48.611 aoe r arcane_barrage Fluffy_Pillow 22412.6/63371: 35% mana arcane_charge(4), rune_of_power
4:49.916 aoe q arcane_explosion Fluffy_Pillow 26601.4/63371: 42% mana rune_of_power
4:51.225 aoe q arcane_explosion Fluffy_Pillow 23260.5/63371: 37% mana arcane_charge, clearcasting, rune_of_power
4:52.533 aoe q arcane_explosion Fluffy_Pillow 24918.3/63371: 39% mana arcane_charge(2)
4:53.840 aoe q arcane_explosion Fluffy_Pillow 21574.8/63371: 34% mana arcane_charge(3)
4:55.146 aoe r arcane_barrage Fluffy_Pillow 18230.1/63371: 29% mana arcane_charge(4)
4:56.450 aoe q arcane_explosion Fluffy_Pillow 22417.7/63371: 35% mana
4:57.756 aoe q arcane_explosion Fluffy_Pillow 19072.9/63371: 30% mana arcane_charge
4:59.061 aoe q arcane_explosion Fluffy_Pillow 15726.9/63371: 25% mana arcane_charge(2)
5:00.367 aoe q arcane_explosion Fluffy_Pillow 12382.2/63371: 20% mana arcane_charge(3)
5:01.674 aoe r arcane_barrage Fluffy_Pillow 9038.7/63371: 14% mana arcane_charge(4), clearcasting
5:02.982 aoe p arcane_orb Fluffy_Pillow 13231.4/63371: 21% mana clearcasting
5:04.287 aoe r arcane_barrage Fluffy_Pillow 14385.4/63371: 23% mana arcane_charge(4), clearcasting
5:05.594 aoe q arcane_explosion Fluffy_Pillow 18576.7/63371: 29% mana clearcasting
5:06.901 aoe q arcane_explosion Fluffy_Pillow 20233.3/63371: 32% mana arcane_charge
5:08.207 aoe q arcane_explosion Fluffy_Pillow 16888.5/63371: 27% mana arcane_charge(2)
5:09.514 aoe q arcane_explosion Fluffy_Pillow 13545.1/63371: 21% mana arcane_charge(3), clearcasting
5:10.821 aoe r arcane_barrage Fluffy_Pillow 15201.6/63371: 24% mana arcane_charge(4)
5:12.127 aoe q arcane_explosion Fluffy_Pillow 19391.7/63371: 31% mana
5:13.434 aoe q arcane_explosion Fluffy_Pillow 16048.2/63371: 25% mana arcane_charge
5:14.742 aoe q arcane_explosion Fluffy_Pillow 12706.0/63371: 20% mana arcane_charge(2)
5:16.049 aoe q arcane_explosion Fluffy_Pillow 9362.6/63371: 15% mana arcane_charge(3)
5:17.355 aoe r arcane_barrage Fluffy_Pillow 6017.8/63371: 9% mana arcane_charge(4)
5:18.662 aoe q arcane_explosion Fluffy_Pillow 10209.2/63371: 16% mana
5:19.969 aoe q arcane_explosion Fluffy_Pillow 6865.7/63371: 11% mana arcane_charge, clearcasting
5:21.277 aoe k touch_of_the_magi Fluffy_Pillow 8523.5/63371: 13% mana arcane_charge(2)
5:22.584 aoe m rune_of_power Fluffy_Pillow 7680.1/63371: 12% mana arcane_charge(4)
5:23.891 aoe r arcane_barrage Fluffy_Pillow 9336.6/63371: 15% mana arcane_charge(4), rune_of_power
5:25.200 aoe p arcane_orb Fluffy_Pillow 13530.5/63371: 21% mana rune_of_power
5:26.508 aoe r arcane_barrage Fluffy_Pillow 14688.3/63371: 23% mana arcane_charge(4), rune_of_power
5:27.813 aoe q arcane_explosion Fluffy_Pillow 18877.2/63371: 30% mana rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Marileth"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream : 11199 dps, 4731 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11199.1 11199.1 15.9 / 0.142% 1045.3 / 9.3% 5.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
1886.6 1783.1 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 11199
Arcane Barrage 4033 36.0% 54.4 5.55sec 22271 17989 Direct 162.8 6247 12433 7438 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.36 162.83 0.00 0.00 1.2380 0.0000 1210631.31 1210631.31 0.00% 17989.38 17989.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 131.49 98 167 6247.26 2082 25140 6250.35 5613 6852 821073 821073 0.00%
crit 19.25% 31.34 15 51 12433.34 4164 50280 12440.01 8191 19510 389559 389559 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.37
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 289 2.6% 41.4 6.90sec 2097 0 Direct 124.3 586 1172 699 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.44 124.32 0.00 0.00 0.0000 0.0000 86891.57 86891.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 100.36 71 134 585.95 443 664 585.91 561 613 58801 58801 0.00%
crit 19.28% 23.96 9 40 1172.23 886 1329 1172.44 1022 1299 28091 28091 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4657 41.6% 142.9 2.08sec 9793 7874 Direct 428.7 2736 5473 3264 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.91 428.74 0.00 0.00 1.2437 0.0000 1399563.86 1399563.86 0.00% 7874.04 7874.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 345.97 263 427 2735.70 1958 4112 2735.45 2630 2824 946506 946506 0.00%
crit 19.31% 82.77 51 120 5473.47 3916 8223 5473.03 4840 5983 453058 453058 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.89
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (884) 0.0% (7.9%) 13.9 22.30sec 19090 15459

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.89 0.00 0.00 0.00 1.2349 0.0000 0.00 0.00 0.00% 15458.88 15458.88

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.89
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 884 7.9% 41.6 22.30sec 6373 0 Direct 41.6 5337 10681 6371 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.62 41.62 0.00 0.00 0.0000 0.0000 265212.48 265212.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 33.56 21 46 5336.67 3869 8126 5346.31 4852 5888 179117 179117 0.00%
crit 19.36% 8.06 1 17 10681.11 7739 16251 10695.59 7739 15168 86095 86095 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (85) 0.0% (0.8%) 18.6 9.00sec 1391 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 85 0.8% 18.6 9.00sec 1391 0 Direct 18.6 1164 2327 1391 19.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.65 18.65 0.00 0.00 0.0000 0.0000 25934.58 25934.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.46% 15.00 5 29 1163.53 1164 1164 1163.53 1164 1164 17456 17456 0.00%
crit 19.54% 3.64 0 11 2327.06 2327 2327 2233.48 0 2327 8478 8478 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1765 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1767.81 1767.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 0.81 0 1 1480.68 1481 1481 1193.54 0 1481 1194 1194 0.00%
crit 19.39% 0.19 0 1 2961.35 2961 2961 574.28 0 2961 574 574 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6038 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6037.95 6037.95 0.00% 51.26 51.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 72.59 62 81 56.24 43 60 56.24 55 58 4083 4083 0.00%
crit 19.34% 17.41 9 28 112.32 86 120 112.35 100 120 1955 1955 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 386 3.5% 6.0 49.54sec 19518 5474 Periodic 70.9 1372 2745 1638 19.4% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 0.00 23.65 70.94 3.5655 0.8342 116184.92 116184.92 0.00% 5474.22 5474.22
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.65% 57.21 38 76 1372.31 1372 1372 1372.31 1372 1372 78506 78506 0.00%
crit 19.35% 13.73 2 26 2744.61 2745 2745 2744.61 2745 2745 37679 37679 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.95
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (838) 0.0% (7.5%) 6.6 49.18sec 38216 29253

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.59 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 29252.87 29252.87

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.62
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 838 7.5% 6.6 49.07sec 38216 0 Direct 19.6 12820 0 12820 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.59 19.65 0.00 0.00 0.0000 0.0000 251662.47 251662.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.65 15 24 12819.84 3377 48579 12832.28 10634 15907 251662 251662 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34891.53
  • base_dd_max:34891.53
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream
Arcane Power 3.6 97.26sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.58
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.82sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.2 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.24 0.00 1.43 0.00 4.2640 0.7211 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.24
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.46sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 48.01sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.39 0.00 0.00 0.00 1.2595 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.41
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.54sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.80
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.1 149.9 5.5sec 1.5sec 4.2sec 76.32% 0.00% 3.5 (5.4) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 9.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • arcane_charge_1:21.31%
  • arcane_charge_2:18.95%
  • arcane_charge_3:14.47%
  • arcane_charge_4:21.60%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.47% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.3s
  • trigger_min/max:96.0s / 102.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.47%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.09% 23.63% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.6s / 199.3s
  • trigger_min/max:192.6s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.09%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 0.2 12.9sec 12.8sec 2.2sec 16.45% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.24%
  • clearcasting_2:0.22%
  • clearcasting_3:0.05%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.2 0.0 0.0sec 0.0sec 4.3sec 0.34% 0.00% 0.9 (0.9) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:0.35%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.3sec 11.32% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.1s
  • trigger_min/max:300.0s / 301.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.32%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.5sec 31.5sec 14.6sec 48.44% 0.00% 0.0 (0.0) 9.5

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.7s
  • trigger_min/max:16.8s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.44%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.58% 0.76% 5.43% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.737144.053263.903
Evocation221.078125.932353.852286.853166.127359.846
Rune of Power14.2480.00836.62994.09476.236110.910
Touch of the Magi10.8810.00017.39873.91157.20593.205
Arcane Power1.2400.0056.2674.4442.1348.858
Arcane Barrage3.0380.00012.243166.557132.342201.030
Arcane Orb4.5990.00012.57764.45647.36881.506
Shifting Power9.3340.00033.25855.66049.87963.413

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
mana_regen Mana 685.73 373549.13 69.65% 544.74 7055.61 1.85%
Evocation Mana 11.41 11476.92 2.14% 1006.05 0.00 0.00%
Mana Gem Mana 2.80 17771.92 3.31% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.37 133492.12 24.89% 2455.45 4317.01 3.13%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1783.11 1886.63 11378.1 32239.6 363.2 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream
arcane_explosion Mana 142.9 528797.4 3700.7 3700.1 2.6
arcane_orb Mana 13.9 6191.2 445.6 445.6 42.8
shifting_power Mana 6.0 14883.3 2500.0 2500.3 7.8
touch_of_the_magi Mana 6.6 16478.0 2500.0 2502.2 15.3

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Dream Damage Per Second
Count 1119
Mean 11199.14
Minimum 10507.67
Maximum 12238.98
Spread ( max - min ) 1731.31
Range [ ( max - min ) / 2 * 100% ] 7.73%
Standard Deviation 271.6912
5th Percentile 10778.80
95th Percentile 11643.53
( 95th Percentile - 5th Percentile ) 864.73
Mean Distribution
Standard Deviation 8.1220
95.00% Confidence Interval ( 11183.22 - 11215.06 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2261
0.1 Scale Factor Error with Delta=300 631
0.05 Scale Factor Error with Delta=300 2521
0.01 Scale Factor Error with Delta=300 63014
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 1119
Mean 4730.72
Minimum 4220.40
Maximum 5286.13
Spread ( max - min ) 1065.73
Range [ ( max - min ) / 2 * 100% ] 11.26%
Standard Deviation 168.7597
5th Percentile 4461.15
95th Percentile 5015.21
( 95th Percentile - 5th Percentile ) 554.06
Mean Distribution
Standard Deviation 5.0449
95.00% Confidence Interval ( 4720.83 - 4740.61 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4889
0.1 Scale Factor Error with Delta=300 244
0.05 Scale Factor Error with Delta=300 973
0.01 Scale Factor Error with Delta=300 24313
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 1119
Mean 11199.14
Minimum 10507.67
Maximum 12238.98
Spread ( max - min ) 1731.31
Range [ ( max - min ) / 2 * 100% ] 7.73%
Damage
NightFae_Dream Damage
Count 1119
Mean 3357849.01
Minimum 2621424.75
Maximum 4026803.77
Spread ( max - min ) 1405379.02
Range [ ( max - min ) / 2 * 100% ] 20.93%
DTPS
NightFae_Dream Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.62 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.58 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.41 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.89 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.95 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.89 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.37 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.24 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.80 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooopmpoooorpoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmpoooopjrlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpoooopoooopmproooopoonoopmpojkpooooposooopoooolpmpoooopoooo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k arcane_power Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4)
0:01.307 shared_cds s potion Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.307 shared_cds t berserking Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.307 aoe p arcane_barrage Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.221 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.136 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.050 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.964 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.879 aoe o arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.794 aoe o arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.709 aoe p arcane_barrage Fluffy_Pillow 58008.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.625 aoe o arcane_explosion Fluffy_Pillow 61704.8/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.539 aoe o arcane_explosion Fluffy_Pillow 60363.2/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.454 aoe o arcane_explosion Fluffy_Pillow 59022.9/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.368 aoe o arcane_explosion Fluffy_Pillow 57681.3/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.283 aoe p arcane_barrage Fluffy_Pillow 56341.0/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.198 aoe o arcane_explosion Fluffy_Pillow 60035.6/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.113 aoe o arcane_explosion Fluffy_Pillow 58695.3/63371: 93% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.120 aoe o arcane_explosion Fluffy_Pillow 57471.6/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.128 aoe o arcane_explosion Fluffy_Pillow 56249.1/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.133 aoe l rune_of_power Fluffy_Pillow 55022.9/63371: 87% mana bloodlust, arcane_charge(4), clearcasting, potion_of_deathly_fixation
0:18.139 aoe p arcane_barrage Fluffy_Pillow 56297.9/63371: 89% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:19.147 aoe o arcane_explosion Fluffy_Pillow 60110.4/63371: 95% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:20.153 aoe o arcane_explosion Fluffy_Pillow 61385.4/63371: 97% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.159 aoe o arcane_explosion Fluffy_Pillow 57660.4/63371: 91% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.165 aoe o arcane_explosion Fluffy_Pillow 53935.5/63371: 85% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, potion_of_deathly_fixation
0:23.172 aoe p arcane_barrage Fluffy_Pillow 55211.8/63371: 87% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.180 aoe m arcane_orb Fluffy_Pillow 59024.2/63371: 93% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.187 aoe p arcane_barrage Fluffy_Pillow 59800.5/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.193 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.199 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.206 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power
0:29.211 aoe o arcane_explosion Fluffy_Pillow 57196.5/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power
0:30.219 shared_cds r use_mana_gem NightFae_Dream 53474.1/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power
0:30.219 aoe p arcane_barrage Fluffy_Pillow 59811.2/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power
0:31.225 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power
0:32.232 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:33.237 aoe n shifting_power Fluffy_Pillow 55921.5/63371: 88% mana bloodlust, arcane_charge(2)
0:36.136 aoe o arcane_explosion Fluffy_Pillow 57095.8/63371: 90% mana bloodlust, arcane_charge(2)
0:37.143 aoe o arcane_explosion Fluffy_Pillow 53372.1/63371: 84% mana bloodlust, arcane_charge(3), clearcasting
0:38.147 aoe p arcane_barrage Fluffy_Pillow 54644.6/63371: 86% mana bloodlust, arcane_charge(4)
0:39.154 aoe m arcane_orb Fluffy_Pillow 58455.7/63371: 92% mana bloodlust
0:40.162 aoe p arcane_barrage Fluffy_Pillow 59233.3/63371: 93% mana bloodlust, arcane_charge(4)
0:41.167 aoe o arcane_explosion Fluffy_Pillow 63041.9/63371: 99% mana
0:42.473 aoe o arcane_explosion Fluffy_Pillow 59697.2/63371: 94% mana arcane_charge
0:43.779 aoe o arcane_explosion Fluffy_Pillow 56352.4/63371: 89% mana arcane_charge(2), clearcasting
0:45.086 aoe o arcane_explosion Fluffy_Pillow 58009.0/63371: 92% mana arcane_charge(3)
0:46.393 aoe p arcane_barrage Fluffy_Pillow 54665.5/63371: 86% mana arcane_charge(4)
0:47.698 aoe o arcane_explosion Fluffy_Pillow 58854.4/63371: 93% mana
0:49.006 aoe o arcane_explosion Fluffy_Pillow 55512.1/63371: 88% mana arcane_charge
0:50.312 aoe j touch_of_the_magi Fluffy_Pillow 52167.4/63371: 82% mana arcane_charge(2), clearcasting
0:51.619 aoe l rune_of_power Fluffy_Pillow 51323.9/63371: 81% mana arcane_charge(4), clearcasting
0:52.925 aoe p arcane_barrage Fluffy_Pillow 52979.2/63371: 84% mana arcane_charge(4), clearcasting, rune_of_power
0:54.231 aoe o arcane_explosion Fluffy_Pillow 57169.3/63371: 90% mana clearcasting, rune_of_power
0:55.536 aoe o arcane_explosion Fluffy_Pillow 58823.3/63371: 93% mana arcane_charge, rune_of_power
0:56.843 aoe o arcane_explosion Fluffy_Pillow 55479.8/63371: 88% mana arcane_charge(2), rune_of_power
0:58.150 aoe o arcane_explosion Fluffy_Pillow 52136.4/63371: 82% mana arcane_charge(3), rune_of_power
0:59.456 aoe p arcane_barrage Fluffy_Pillow 48791.6/63371: 77% mana arcane_charge(4), rune_of_power
1:00.764 aoe m arcane_orb Fluffy_Pillow 52984.3/63371: 84% mana rune_of_power
1:02.071 aoe p arcane_barrage Fluffy_Pillow 54140.8/63371: 85% mana arcane_charge(4), rune_of_power
1:03.376 aoe o arcane_explosion Fluffy_Pillow 58329.7/63371: 92% mana rune_of_power
1:04.684 aoe o arcane_explosion Fluffy_Pillow 54987.5/63371: 87% mana arcane_charge, rune_of_power
1:05.989 aoe o arcane_explosion Fluffy_Pillow 51641.5/63371: 81% mana arcane_charge(2), rune_of_power
1:07.296 aoe o arcane_explosion Fluffy_Pillow 48298.0/63371: 76% mana arcane_charge(3), rune_of_power
1:08.603 aoe p arcane_barrage Fluffy_Pillow 44954.5/63371: 71% mana arcane_charge(4)
1:09.910 aoe o arcane_explosion Fluffy_Pillow 49145.9/63371: 78% mana
1:11.216 aoe o arcane_explosion Fluffy_Pillow 45801.2/63371: 72% mana arcane_charge
1:12.522 aoe o arcane_explosion Fluffy_Pillow 42456.4/63371: 67% mana arcane_charge(2)
1:13.829 aoe o arcane_explosion Fluffy_Pillow 39113.0/63371: 62% mana arcane_charge(3)
1:15.133 aoe p arcane_barrage Fluffy_Pillow 35765.7/63371: 56% mana arcane_charge(4)
1:16.439 aoe o arcane_explosion Fluffy_Pillow 39955.8/63371: 63% mana
1:17.744 aoe o arcane_explosion Fluffy_Pillow 36609.8/63371: 58% mana arcane_charge
1:19.051 aoe n shifting_power Fluffy_Pillow 33266.3/63371: 52% mana arcane_charge(2)
1:22.847 aoe o arcane_explosion Fluffy_Pillow 35577.5/63371: 56% mana arcane_charge(2)
1:24.152 aoe o arcane_explosion Fluffy_Pillow 32231.5/63371: 51% mana arcane_charge(3)
1:25.459 aoe p arcane_barrage Fluffy_Pillow 28888.0/63371: 46% mana arcane_charge(4)
1:26.766 aoe m arcane_orb Fluffy_Pillow 33079.4/63371: 52% mana
1:28.073 aoe p arcane_barrage Fluffy_Pillow 34235.9/63371: 54% mana arcane_charge(4)
1:29.379 aoe o arcane_explosion Fluffy_Pillow 38426.0/63371: 61% mana
1:30.686 aoe o arcane_explosion Fluffy_Pillow 35082.6/63371: 55% mana arcane_charge
1:31.992 aoe o arcane_explosion Fluffy_Pillow 31737.8/63371: 50% mana arcane_charge(2)
1:33.299 aoe o arcane_explosion Fluffy_Pillow 28394.4/63371: 45% mana arcane_charge(3)
1:34.605 aoe p arcane_barrage Fluffy_Pillow 25049.6/63371: 40% mana arcane_charge(4)
1:35.911 aoe o arcane_explosion Fluffy_Pillow 29239.7/63371: 46% mana
1:37.217 aoe j touch_of_the_magi Fluffy_Pillow 25895.0/63371: 41% mana arcane_charge
1:38.526 aoe k arcane_power Fluffy_Pillow 25054.1/63371: 40% mana arcane_charge(4)
1:38.526 aoe p arcane_barrage Fluffy_Pillow 25054.1/63371: 40% mana arcane_charge(4), arcane_power, rune_of_power
1:39.833 aoe o arcane_explosion Fluffy_Pillow 29245.5/63371: 46% mana arcane_power, rune_of_power
1:41.139 aoe o arcane_explosion Fluffy_Pillow 28400.7/63371: 45% mana arcane_charge, arcane_power, clearcasting, rune_of_power
1:42.445 aoe o arcane_explosion Fluffy_Pillow 30056.0/63371: 47% mana arcane_charge(2), arcane_power, rune_of_power
1:43.752 aoe o arcane_explosion Fluffy_Pillow 29212.5/63371: 46% mana arcane_charge(3), arcane_power, rune_of_power
1:45.060 aoe p arcane_barrage Fluffy_Pillow 28370.3/63371: 45% mana arcane_charge(4), arcane_power, rune_of_power
1:46.366 aoe o arcane_explosion Fluffy_Pillow 32560.4/63371: 51% mana arcane_power, rune_of_power
1:47.673 aoe o arcane_explosion Fluffy_Pillow 31717.0/63371: 50% mana arcane_charge, arcane_power, clearcasting, rune_of_power
1:48.979 aoe o arcane_explosion Fluffy_Pillow 33372.2/63371: 53% mana arcane_charge(2), arcane_power, rune_of_power
1:50.285 aoe o arcane_explosion Fluffy_Pillow 32527.5/63371: 51% mana arcane_charge(3), arcane_power, rune_of_power
1:51.592 aoe p arcane_barrage Fluffy_Pillow 31684.0/63371: 50% mana arcane_charge(4), arcane_power, rune_of_power
1:52.899 aoe m arcane_orb Fluffy_Pillow 35875.4/63371: 57% mana arcane_power, rune_of_power
1:54.205 aoe l rune_of_power Fluffy_Pillow 37280.7/63371: 59% mana arcane_charge(4)
1:55.512 aoe p arcane_barrage Fluffy_Pillow 38937.2/63371: 61% mana arcane_charge(4), rune_of_power
1:56.819 aoe o arcane_explosion Fluffy_Pillow 43128.6/63371: 68% mana rune_of_power
1:58.126 aoe o arcane_explosion Fluffy_Pillow 39785.1/63371: 63% mana arcane_charge, rune_of_power
1:59.434 aoe o arcane_explosion Fluffy_Pillow 36442.9/63371: 58% mana arcane_charge(2), rune_of_power
2:00.740 aoe o arcane_explosion Fluffy_Pillow 33098.2/63371: 52% mana arcane_charge(3), rune_of_power
2:02.046 aoe p arcane_barrage Fluffy_Pillow 29753.4/63371: 47% mana arcane_charge(4), rune_of_power
2:03.353 aoe o arcane_explosion Fluffy_Pillow 33944.8/63371: 54% mana rune_of_power
2:04.658 aoe o arcane_explosion Fluffy_Pillow 30598.8/63371: 48% mana arcane_charge, rune_of_power
2:05.965 aoe o arcane_explosion Fluffy_Pillow 27255.3/63371: 43% mana arcane_charge(2), clearcasting, rune_of_power
2:07.272 aoe o arcane_explosion Fluffy_Pillow 28911.9/63371: 46% mana arcane_charge(3), rune_of_power
2:08.579 aoe p arcane_barrage Fluffy_Pillow 25568.4/63371: 40% mana arcane_charge(4), rune_of_power
2:09.885 aoe o arcane_explosion Fluffy_Pillow 29758.5/63371: 47% mana rune_of_power
2:11.191 aoe n shifting_power Fluffy_Pillow 26413.8/63371: 42% mana arcane_charge
2:14.822 aoe o arcane_explosion Fluffy_Pillow 28515.8/63371: 45% mana arcane_charge
2:16.127 aoe o arcane_explosion Fluffy_Pillow 25169.8/63371: 40% mana arcane_charge(2)
2:17.435 aoe o arcane_explosion Fluffy_Pillow 21827.6/63371: 34% mana arcane_charge(3)
2:18.743 aoe p arcane_barrage Fluffy_Pillow 18485.4/63371: 29% mana arcane_charge(4)
2:20.050 aoe m arcane_orb Fluffy_Pillow 22676.8/63371: 36% mana
2:21.356 aoe p arcane_barrage Fluffy_Pillow 23832.0/63371: 38% mana arcane_charge(4)
2:22.663 aoe o arcane_explosion Fluffy_Pillow 28023.4/63371: 44% mana
2:23.970 aoe o arcane_explosion Fluffy_Pillow 24679.9/63371: 39% mana arcane_charge
2:25.275 aoe o arcane_explosion Fluffy_Pillow 21333.9/63371: 34% mana arcane_charge(2)
2:26.580 aoe o arcane_explosion Fluffy_Pillow 17987.9/63371: 28% mana arcane_charge(3)
2:27.886 aoe p arcane_barrage Fluffy_Pillow 14643.2/63371: 23% mana arcane_charge(4)
2:29.193 aoe j touch_of_the_magi Fluffy_Pillow 18834.6/63371: 30% mana
2:30.500 shared_cds r use_mana_gem NightFae_Dream 17991.1/63371: 28% mana arcane_charge(4)
2:30.500 aoe l rune_of_power Fluffy_Pillow 24328.3/63371: 38% mana arcane_charge(4)
2:31.806 aoe p arcane_barrage Fluffy_Pillow 25983.5/63371: 41% mana arcane_charge(4), rune_of_power
2:33.114 aoe o arcane_explosion Fluffy_Pillow 30176.2/63371: 48% mana rune_of_power
2:34.422 aoe o arcane_explosion Fluffy_Pillow 26834.0/63371: 42% mana arcane_charge, rune_of_power
2:35.728 aoe o arcane_explosion Fluffy_Pillow 23489.2/63371: 37% mana arcane_charge(2), rune_of_power
2:37.034 aoe o arcane_explosion Fluffy_Pillow 20144.5/63371: 32% mana arcane_charge(3), rune_of_power
2:38.341 aoe p arcane_barrage Fluffy_Pillow 16801.0/63371: 27% mana arcane_charge(4), clearcasting, rune_of_power
2:39.648 aoe o arcane_explosion Fluffy_Pillow 20992.4/63371: 33% mana clearcasting, rune_of_power
2:40.955 aoe o arcane_explosion Fluffy_Pillow 22648.9/63371: 36% mana arcane_charge, rune_of_power
2:42.261 aoe o arcane_explosion Fluffy_Pillow 19304.2/63371: 30% mana arcane_charge(2), clearcasting, rune_of_power
2:43.568 aoe o arcane_explosion Fluffy_Pillow 20960.7/63371: 33% mana arcane_charge(3), rune_of_power
2:44.874 aoe p arcane_barrage Fluffy_Pillow 17616.0/63371: 28% mana arcane_charge(4), clearcasting, rune_of_power
2:46.181 aoe m arcane_orb Fluffy_Pillow 21807.4/63371: 34% mana clearcasting, rune_of_power
2:47.488 aoe p arcane_barrage Fluffy_Pillow 22963.9/63371: 36% mana arcane_charge(4), clearcasting
2:48.794 aoe o arcane_explosion Fluffy_Pillow 27154.0/63371: 43% mana clearcasting
2:50.100 aoe o arcane_explosion Fluffy_Pillow 28809.3/63371: 45% mana arcane_charge
2:51.406 aoe o arcane_explosion Fluffy_Pillow 25464.5/63371: 40% mana arcane_charge(2)
2:52.713 aoe o arcane_explosion Fluffy_Pillow 22121.1/63371: 35% mana arcane_charge(3)
2:54.019 aoe p arcane_barrage Fluffy_Pillow 18776.3/63371: 30% mana arcane_charge(4), clearcasting
2:55.325 aoe o arcane_explosion Fluffy_Pillow 22966.5/63371: 36% mana clearcasting
2:56.631 aoe n shifting_power Fluffy_Pillow 24621.7/63371: 39% mana arcane_charge
3:00.366 aoe o arcane_explosion Fluffy_Pillow 26855.6/63371: 42% mana arcane_charge
3:01.671 aoe o arcane_explosion Fluffy_Pillow 23509.6/63371: 37% mana arcane_charge(2)
3:02.977 aoe o arcane_explosion Fluffy_Pillow 20164.8/63371: 32% mana arcane_charge(3)
3:04.283 aoe p arcane_barrage Fluffy_Pillow 16820.1/63371: 27% mana arcane_charge(4)
3:05.591 aoe m arcane_orb Fluffy_Pillow 21012.7/63371: 33% mana
3:06.898 aoe p arcane_barrage Fluffy_Pillow 22169.3/63371: 35% mana arcane_charge(4)
3:08.203 aoe o arcane_explosion Fluffy_Pillow 26358.1/63371: 42% mana
3:09.510 aoe o arcane_explosion Fluffy_Pillow 23014.6/63371: 36% mana arcane_charge
3:10.818 aoe o arcane_explosion Fluffy_Pillow 19672.4/63371: 31% mana arcane_charge(2)
3:12.124 aoe o arcane_explosion Fluffy_Pillow 16327.7/63371: 26% mana arcane_charge(3), clearcasting
3:13.431 aoe p arcane_barrage Fluffy_Pillow 17984.2/63371: 28% mana arcane_charge(4)
3:14.736 aoe j touch_of_the_magi Fluffy_Pillow 22173.1/63371: 35% mana
3:16.042 aoe k arcane_power Fluffy_Pillow 21328.3/63371: 34% mana arcane_charge(4)
3:16.042 shared_cds t berserking Fluffy_Pillow 21328.3/63371: 34% mana arcane_charge(4), arcane_power, rune_of_power
3:16.042 aoe p arcane_barrage Fluffy_Pillow 21328.3/63371: 34% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.230 aoe o arcane_explosion Fluffy_Pillow 25368.9/63371: 40% mana berserking, arcane_power, rune_of_power
3:18.420 aoe o arcane_explosion Fluffy_Pillow 24377.1/63371: 38% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power
3:19.609 aoe o arcane_explosion Fluffy_Pillow 25884.1/63371: 41% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.796 aoe o arcane_explosion Fluffy_Pillow 24888.6/63371: 39% mana berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power
3:21.984 aoe p arcane_barrage Fluffy_Pillow 26394.3/63371: 42% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.174 aoe o arcane_explosion Fluffy_Pillow 30437.4/63371: 48% mana berserking, arcane_power, rune_of_power
3:24.364 aoe o arcane_explosion Fluffy_Pillow 29445.6/63371: 46% mana berserking, arcane_charge, arcane_power, rune_of_power
3:25.553 aoe o arcane_explosion Fluffy_Pillow 28452.6/63371: 45% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:26.740 aoe o arcane_explosion Fluffy_Pillow 27457.0/63371: 43% mana berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power
3:27.930 aoe p arcane_barrage Fluffy_Pillow 28965.3/63371: 46% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:29.118 aoe m arcane_orb Fluffy_Pillow 33005.8/63371: 52% mana arcane_power, rune_of_power
3:30.425 aoe p arcane_barrage Fluffy_Pillow 34412.3/63371: 54% mana arcane_charge(4), arcane_power, rune_of_power
3:31.829 aoe o arcane_explosion Fluffy_Pillow 38726.7/63371: 61% mana
3:33.136 aoe o arcane_explosion Fluffy_Pillow 35383.2/63371: 56% mana arcane_charge
3:34.445 aoe o arcane_explosion Fluffy_Pillow 32042.3/63371: 51% mana arcane_charge(2)
3:35.752 aoe o arcane_explosion Fluffy_Pillow 28698.8/63371: 45% mana arcane_charge(3)
3:37.057 aoe l rune_of_power Fluffy_Pillow 25352.8/63371: 40% mana arcane_charge(4)
3:38.364 aoe p arcane_barrage Fluffy_Pillow 27009.3/63371: 43% mana arcane_charge(4), rune_of_power
3:39.670 aoe o arcane_explosion Fluffy_Pillow 31199.4/63371: 49% mana rune_of_power
3:40.976 aoe o arcane_explosion Fluffy_Pillow 27854.7/63371: 44% mana arcane_charge, rune_of_power
3:42.282 aoe o arcane_explosion Fluffy_Pillow 24510.0/63371: 39% mana arcane_charge(2), rune_of_power
3:43.588 aoe o arcane_explosion Fluffy_Pillow 21165.2/63371: 33% mana arcane_charge(3), rune_of_power
3:44.894 aoe p arcane_barrage Fluffy_Pillow 17820.5/63371: 28% mana arcane_charge(4), clearcasting, rune_of_power
3:46.202 aoe o arcane_explosion Fluffy_Pillow 22013.1/63371: 35% mana clearcasting, rune_of_power
3:47.509 aoe o arcane_explosion Fluffy_Pillow 23669.7/63371: 37% mana arcane_charge, rune_of_power
3:48.815 aoe o arcane_explosion Fluffy_Pillow 20324.9/63371: 32% mana arcane_charge(2), rune_of_power
3:50.119 aoe o arcane_explosion Fluffy_Pillow 16977.7/63371: 27% mana arcane_charge(3), rune_of_power
3:51.426 aoe p arcane_barrage Fluffy_Pillow 13634.2/63371: 22% mana arcane_charge(4), rune_of_power
3:52.733 aoe m arcane_orb Fluffy_Pillow 17825.6/63371: 28% mana rune_of_power
3:54.039 aoe n shifting_power Fluffy_Pillow 18980.8/63371: 30% mana arcane_charge(4)
3:57.737 aoe p arcane_barrage Fluffy_Pillow 21167.8/63371: 33% mana arcane_charge(4)
3:59.044 aoe o arcane_explosion Fluffy_Pillow 25359.2/63371: 40% mana
4:00.351 aoe o arcane_explosion Fluffy_Pillow 22015.7/63371: 35% mana arcane_charge
4:01.656 aoe o arcane_explosion Fluffy_Pillow 18669.7/63371: 29% mana arcane_charge(2), clearcasting
4:02.960 aoe o arcane_explosion Fluffy_Pillow 20322.4/63371: 32% mana arcane_charge(3)
4:04.267 aoe p arcane_barrage Fluffy_Pillow 16978.9/63371: 27% mana arcane_charge(4)
4:05.573 aoe m arcane_orb Fluffy_Pillow 21169.1/63371: 33% mana
4:06.878 aoe p arcane_barrage Fluffy_Pillow 22323.1/63371: 35% mana arcane_charge(4)
4:08.184 aoe o arcane_explosion Fluffy_Pillow 26513.2/63371: 42% mana
4:09.493 aoe o arcane_explosion Fluffy_Pillow 23172.2/63371: 37% mana arcane_charge
4:10.798 aoe j touch_of_the_magi Fluffy_Pillow 19826.2/63371: 31% mana arcane_charge(2), clearcasting
4:12.105 aoe l rune_of_power Fluffy_Pillow 18982.8/63371: 30% mana arcane_charge(4), clearcasting
4:13.412 aoe p arcane_barrage Fluffy_Pillow 20639.3/63371: 33% mana arcane_charge(4), clearcasting, rune_of_power
4:14.719 aoe o arcane_explosion Fluffy_Pillow 24830.7/63371: 39% mana clearcasting, rune_of_power
4:16.025 aoe o arcane_explosion Fluffy_Pillow 26485.9/63371: 42% mana arcane_charge, rune_of_power
4:17.332 aoe o arcane_explosion Fluffy_Pillow 23142.5/63371: 37% mana arcane_charge(2), clearcasting, rune_of_power
4:18.640 aoe o arcane_explosion Fluffy_Pillow 24800.3/63371: 39% mana arcane_charge(3), rune_of_power
4:19.946 aoe p arcane_barrage Fluffy_Pillow 21455.5/63371: 34% mana arcane_charge(4), rune_of_power
4:21.252 aoe o arcane_explosion Fluffy_Pillow 25645.6/63371: 40% mana rune_of_power
4:22.558 aoe o arcane_explosion Fluffy_Pillow 22300.9/63371: 35% mana arcane_charge, rune_of_power
4:23.864 aoe o arcane_explosion Fluffy_Pillow 18956.2/63371: 30% mana arcane_charge(2), rune_of_power
4:25.172 aoe o arcane_explosion Fluffy_Pillow 15614.0/63371: 25% mana arcane_charge(3), clearcasting, rune_of_power
4:26.477 aoe p arcane_barrage Fluffy_Pillow 17268.0/63371: 27% mana arcane_charge(4), rune_of_power
4:27.786 aoe m arcane_orb Fluffy_Pillow 21461.9/63371: 34% mana rune_of_power
4:29.092 aoe p arcane_barrage Fluffy_Pillow 22617.1/63371: 36% mana arcane_charge(4)
4:30.399 shared_cds r use_mana_gem NightFae_Dream 26808.5/63371: 42% mana
4:30.500 aoe o arcane_explosion Fluffy_Pillow 33273.7/63371: 53% mana
4:31.806 aoe o arcane_explosion Fluffy_Pillow 29928.9/63371: 47% mana arcane_charge
4:33.112 aoe o arcane_explosion Fluffy_Pillow 26584.2/63371: 42% mana arcane_charge(2)
4:34.418 aoe o arcane_explosion Fluffy_Pillow 23239.5/63371: 37% mana arcane_charge(3)
4:35.724 aoe p arcane_barrage Fluffy_Pillow 19894.7/63371: 31% mana arcane_charge(4)
4:37.030 aoe o arcane_explosion Fluffy_Pillow 24084.9/63371: 38% mana
4:38.336 aoe o arcane_explosion Fluffy_Pillow 20740.1/63371: 33% mana arcane_charge
4:39.645 aoe n shifting_power Fluffy_Pillow 17399.2/63371: 27% mana arcane_charge(2)
4:43.417 aoe o arcane_explosion Fluffy_Pillow 19679.9/63371: 31% mana arcane_charge(2)
4:44.724 aoe o arcane_explosion Fluffy_Pillow 16336.4/63371: 26% mana arcane_charge(3)
4:46.032 aoe p arcane_barrage Fluffy_Pillow 12994.2/63371: 21% mana arcane_charge(4), clearcasting
4:47.338 aoe m arcane_orb Fluffy_Pillow 17184.4/63371: 27% mana clearcasting
4:48.642 aoe p arcane_barrage Fluffy_Pillow 18337.1/63371: 29% mana arcane_charge(4), clearcasting
4:49.946 aoe o arcane_explosion Fluffy_Pillow 22524.7/63371: 36% mana clearcasting
4:51.251 aoe j touch_of_the_magi Fluffy_Pillow 24178.7/63371: 38% mana arcane_charge
4:52.555 aoe k arcane_power Fluffy_Pillow 23331.4/63371: 37% mana arcane_charge(4)
4:52.555 aoe p arcane_barrage Fluffy_Pillow 23331.4/63371: 37% mana arcane_charge(4), arcane_power, rune_of_power
4:53.863 aoe o arcane_explosion Fluffy_Pillow 27524.0/63371: 43% mana arcane_power, rune_of_power
4:55.170 aoe o arcane_explosion Fluffy_Pillow 26680.6/63371: 42% mana arcane_charge, arcane_power, rune_of_power
4:56.476 aoe o arcane_explosion Fluffy_Pillow 25835.8/63371: 41% mana arcane_charge(2), arcane_power, rune_of_power
4:57.784 aoe o arcane_explosion Fluffy_Pillow 24993.6/63371: 39% mana arcane_charge(3), arcane_power, rune_of_power
4:59.090 aoe p arcane_barrage Fluffy_Pillow 24148.9/63371: 38% mana arcane_charge(4), arcane_power, rune_of_power
5:00.398 aoe o arcane_explosion Fluffy_Pillow 28341.6/63371: 45% mana arcane_power, rune_of_power
5:01.704 shared_cds s potion Fluffy_Pillow 27496.8/63371: 43% mana arcane_charge, arcane_power, rune_of_power
5:01.704 aoe o arcane_explosion Fluffy_Pillow 27496.8/63371: 43% mana arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
5:03.008 aoe o arcane_explosion Fluffy_Pillow 26649.5/63371: 42% mana arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
5:04.315 aoe o arcane_explosion Fluffy_Pillow 25806.1/63371: 41% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
5:05.621 aoe p arcane_barrage Fluffy_Pillow 27461.3/63371: 43% mana arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
5:06.928 aoe o arcane_explosion Fluffy_Pillow 31652.7/63371: 50% mana arcane_power, rune_of_power, potion_of_deathly_fixation
5:08.234 aoe o arcane_explosion Fluffy_Pillow 30808.0/63371: 49% mana arcane_charge, potion_of_deathly_fixation
5:09.539 aoe o arcane_explosion Fluffy_Pillow 27462.0/63371: 43% mana arcane_charge(2), potion_of_deathly_fixation
5:10.847 aoe o arcane_explosion Fluffy_Pillow 24119.8/63371: 38% mana arcane_charge(3), potion_of_deathly_fixation
5:12.152 aoe l rune_of_power Fluffy_Pillow 20773.8/63371: 33% mana arcane_charge(4), potion_of_deathly_fixation
5:13.460 aoe p arcane_barrage Fluffy_Pillow 22431.6/63371: 35% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:14.765 aoe m arcane_orb Fluffy_Pillow 26620.4/63371: 42% mana rune_of_power, potion_of_deathly_fixation
5:16.070 aoe p arcane_barrage Fluffy_Pillow 27774.4/63371: 44% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:17.378 aoe o arcane_explosion Fluffy_Pillow 31967.1/63371: 50% mana rune_of_power, potion_of_deathly_fixation
5:18.685 aoe o arcane_explosion Fluffy_Pillow 28623.6/63371: 45% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:19.991 aoe o arcane_explosion Fluffy_Pillow 25278.9/63371: 40% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:21.298 aoe o arcane_explosion Fluffy_Pillow 21935.4/63371: 35% mana arcane_charge(3), rune_of_power, potion_of_deathly_fixation
5:22.604 aoe p arcane_barrage Fluffy_Pillow 18590.6/63371: 29% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:23.912 aoe o arcane_explosion Fluffy_Pillow 22783.3/63371: 36% mana rune_of_power, potion_of_deathly_fixation
5:25.217 aoe o arcane_explosion Fluffy_Pillow 19437.3/63371: 31% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:26.525 aoe o arcane_explosion Fluffy_Pillow 16095.1/63371: 25% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:27.832 aoe o arcane_explosion Fluffy_Pillow 12751.6/63371: 20% mana arcane_charge(3), clearcasting, rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream_SB : 11352 dps, 4798 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11352.4 11352.4 15.8 / 0.139% 1042.9 / 9.2% 6.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
1884.5 1781.5 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream_SB 11352
Arcane Barrage 4091 36.0% 54.4 5.54sec 22582 18240 Direct 162.9 6324 12633 7542 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.38 162.89 0.00 0.00 1.2381 0.0000 1227962.84 1227962.84 0.00% 18240.41 18240.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 131.45 95 165 6323.93 2082 25810 6327.58 5575 6937 831016 831016 0.00%
crit 19.31% 31.45 16 54 12633.21 4164 51620 12641.48 8285 21148 396947 396947 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.38
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 293 2.6% 41.5 6.89sec 2123 0 Direct 124.4 593 1188 708 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.46 124.39 0.00 0.00 0.0000 0.0000 88003.90 88003.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 100.49 70 131 593.20 443 682 593.19 569 619 59607 59607 0.00%
crit 19.21% 23.89 10 41 1188.47 886 1364 1188.33 1045 1316 28397 28397 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4717 41.6% 142.9 2.08sec 9919 7975 Direct 428.7 2772 5543 3306 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.92 428.75 0.00 0.00 1.2437 0.0000 1417624.31 1417624.31 0.00% 7975.43 7975.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 346.09 268 422 2771.96 1958 4221 2771.62 2676 2868 959409 959409 0.00%
crit 19.28% 82.66 51 120 5543.39 3916 8442 5543.57 4933 6131 458215 458215 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.90
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (897) 0.0% (7.9%) 13.9 22.25sec 19366 15681

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.90 0.00 0.00 0.00 1.2350 0.0000 0.00 0.00 0.00% 15681.09 15681.09

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.90
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 897 7.9% 41.6 22.25sec 6466 0 Direct 41.6 5413 10863 6466 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.63 41.63 0.00 0.00 0.0000 0.0000 269165.85 269165.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 33.59 21 47 5413.06 3869 8342 5422.07 4889 5999 181842 181842 0.00%
crit 19.30% 8.03 1 17 10863.08 7739 16685 10887.07 7739 16468 87324 87324 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (0.8%) 18.7 9.17sec 1410 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.66 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 0.8% 18.7 9.17sec 1410 0 Direct 18.7 1181 2362 1409 19.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.66 18.66 0.00 0.00 0.0000 0.0000 26313.07 26313.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 15.05 5 29 1181.39 1164 1195 1181.46 1167 1195 17783 17783 0.00%
crit 19.35% 3.61 0 12 2362.02 2327 2389 2275.69 0 2389 8530 8530 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1520 3040 1808 19.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1810.88 1810.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 0.81 0 1 1520.16 1520 1520 1229.44 0 1520 1229 1229 0.00%
crit 19.12% 0.19 0 1 3040.32 3040 3040 581.44 0 3040 581 581 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.2%) 1.0 0.00sec 6112 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 153  / 21 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6112.42 6112.42 0.00% 51.90 51.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 72.69 59 84 56.96 43 62 56.96 56 58 4140 4140 0.00%
crit 19.23% 17.31 6 31 113.96 86 124 113.95 101 123 1972 1972 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 392 3.5% 6.0 49.49sec 19804 5552 Periodic 71.0 1394 2789 1662 19.2% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 0.00 23.65 70.95 3.5671 0.8342 117923.72 117923.72 0.00% 5552.23 5552.23
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.79% 57.33 39 77 1394.18 1372 1409 1394.01 1387 1400 79922 79922 0.00%
crit 19.21% 13.63 2 26 2788.85 2745 2818 2788.61 2753 2818 38002 38002 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.96
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (850) 0.0% (7.5%) 6.6 49.15sec 38778 29682

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.58 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 29681.88 29681.88

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.63
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 850 7.5% 6.6 49.05sec 38778 0 Direct 19.7 13006 0 13006 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.58 19.65 0.00 0.00 0.0000 0.0000 255264.15 255264.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.65 15 24 13005.99 3377 49440 13009.15 10964 16545 255264 255264 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:26444.65
  • base_dd_max:26444.65
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream_SB
Arcane Power 3.6 97.20sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.58
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.64sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.2 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.23 0.00 1.35 0.00 4.2731 0.7213 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.23
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.52sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 47.97sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.38 0.00 0.00 0.00 1.2595 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.41
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.74sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.81
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.1 149.9 5.5sec 1.5sec 4.2sec 76.28% 0.00% 3.5 (5.4) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.1s
  • trigger_min/max:0.0s / 9.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.6s

Stack Uptimes

  • arcane_charge_1:21.31%
  • arcane_charge_2:18.91%
  • arcane_charge_3:14.49%
  • arcane_charge_4:21.58%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.4s
  • trigger_min/max:96.0s / 102.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.09% 23.63% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.7s / 199.2s
  • trigger_min/max:192.7s / 199.2s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.09%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.6 0.3 12.9sec 12.7sec 2.2sec 16.48% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.24%
  • clearcasting_2:0.25%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.2 0.0 0.0sec 0.0sec 4.3sec 0.32% 0.00% 0.9 (0.9) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 4.3s

Stack Uptimes

  • evocation_1:0.33%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.3sec 11.32% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.1s
  • trigger_min/max:300.0s / 301.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.32%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.5sec 31.5sec 14.6sec 48.45% 0.00% 0.0 (0.0) 9.5

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.8s
  • trigger_min/max:16.8s / 48.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.45%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Social Butterfly 30.6 0.0 10.0sec 10.0sec 5.0sec 50.42% 0.00% 0.0 (0.0) 30.1

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.42%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.58% 0.76% 5.00% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.737144.053263.903
Evocation227.499127.244353.607287.604175.163359.903
Rune of Power14.2520.00836.69094.06976.158111.375
Touch of the Magi10.8700.00019.03873.87556.78192.469
Arcane Power1.2310.0046.4034.4082.0128.821
Arcane Barrage3.0360.00012.278166.489132.357201.869
Arcane Orb4.6020.00013.28164.54844.75781.853
Shifting Power9.3300.00033.25755.64249.30363.190

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream_SB
mana_regen Mana 685.24 373527.10 69.73% 545.11 7089.53 1.86%
Evocation Mana 10.78 10842.83 2.02% 1005.85 0.00 0.00%
Mana Gem Mana 2.81 17805.42 3.32% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.38 133530.51 24.93% 2455.32 4325.51 3.14%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1781.46 1884.49 11410.9 32384.9 1488.6 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream_SB
arcane_explosion Mana 142.9 528145.4 3695.9 3695.5 2.7
arcane_orb Mana 13.9 6190.7 445.4 445.4 43.5
shifting_power Mana 6.0 14887.7 2500.0 2500.3 7.9
touch_of_the_magi Mana 6.6 16471.4 2500.0 2502.2 15.5

Statistics & Data Analysis

Fight Length
NightFae_Dream_SB Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Dream_SB Damage Per Second
Count 1119
Mean 11352.37
Minimum 10618.30
Maximum 12158.33
Spread ( max - min ) 1540.03
Range [ ( max - min ) / 2 * 100% ] 6.78%
Standard Deviation 269.2214
5th Percentile 10914.91
95th Percentile 11794.04
( 95th Percentile - 5th Percentile ) 879.14
Mean Distribution
Standard Deviation 8.0481
95.00% Confidence Interval ( 11336.60 - 11368.15 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2161
0.1 Scale Factor Error with Delta=300 619
0.05 Scale Factor Error with Delta=300 2475
0.01 Scale Factor Error with Delta=300 61874
Priority Target DPS
NightFae_Dream_SB Priority Target Damage Per Second
Count 1119
Mean 4798.21
Minimum 4320.59
Maximum 5401.78
Spread ( max - min ) 1081.19
Range [ ( max - min ) / 2 * 100% ] 11.27%
Standard Deviation 170.3472
5th Percentile 4527.17
95th Percentile 5087.26
( 95th Percentile - 5th Percentile ) 560.09
Mean Distribution
Standard Deviation 5.0924
95.00% Confidence Interval ( 4788.23 - 4808.19 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4842
0.1 Scale Factor Error with Delta=300 248
0.05 Scale Factor Error with Delta=300 991
0.01 Scale Factor Error with Delta=300 24772
DPS(e)
NightFae_Dream_SB Damage Per Second (Effective)
Count 1119
Mean 11352.37
Minimum 10618.30
Maximum 12158.33
Spread ( max - min ) 1540.03
Range [ ( max - min ) / 2 * 100% ] 6.78%
Damage
NightFae_Dream_SB Damage
Count 1119
Mean 3404068.70
Minimum 2691215.85
Maximum 4142058.64
Spread ( max - min ) 1450842.80
Range [ ( max - min ) / 2 * 100% ] 21.31%
DTPS
NightFae_Dream_SB Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream_SB Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream_SB Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream_SB Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream_SB Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream_SB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Dream_SBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream_SB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.63 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.58 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.41 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.90 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.96 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.90 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.38 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.23 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.81 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmporooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpoooopooroopmpoooopoonoopmpojkpooooposooopoooolpmpoooopoooo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana clearcasting, social_butterfly
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), clearcasting, social_butterfly
0:01.306 shared_cds s potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, social_butterfly
0:01.306 shared_cds t berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:01.306 aoe p arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:02.219 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:03.132 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.045 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.960 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:05.874 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.790 aoe o arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.704 aoe p arcane_barrage Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.618 aoe o arcane_explosion Fluffy_Pillow 63042.5/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.532 aoe o arcane_explosion Fluffy_Pillow 61701.0/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.446 aoe o arcane_explosion Fluffy_Pillow 60359.4/63371: 95% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:11.361 aoe o arcane_explosion Fluffy_Pillow 59019.1/63371: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:12.274 aoe p arcane_barrage Fluffy_Pillow 57676.3/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:13.189 aoe o arcane_explosion Fluffy_Pillow 61370.8/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:14.105 aoe o arcane_explosion Fluffy_Pillow 60031.8/63371: 95% mana bloodlust, arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:15.111 aoe o arcane_explosion Fluffy_Pillow 58806.8/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:16.116 aoe o arcane_explosion Fluffy_Pillow 60080.6/63371: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.120 aoe l rune_of_power Fluffy_Pillow 58853.1/63371: 93% mana bloodlust, arcane_charge(4), clearcasting, potion_of_deathly_fixation
0:18.125 aoe p arcane_barrage Fluffy_Pillow 60126.8/63371: 95% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:19.132 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:20.139 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:21.148 aoe o arcane_explosion Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:22.154 aoe o arcane_explosion Fluffy_Pillow 55925.3/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:23.161 shared_cds r use_mana_gem NightFae_Dream_SB 52201.6/63371: 82% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:23.161 aoe p arcane_barrage Fluffy_Pillow 58538.7/63371: 92% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:24.170 aoe m arcane_orb Fluffy_Pillow 62352.4/63371: 98% mana bloodlust, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:25.177 aoe p arcane_barrage Fluffy_Pillow 63128.7/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.182 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.189 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.197 aoe o arcane_explosion Fluffy_Pillow 55925.3/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:29.203 aoe o arcane_explosion Fluffy_Pillow 52200.3/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:30.209 aoe p arcane_barrage Fluffy_Pillow 48475.4/63371: 76% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, social_butterfly
0:31.215 aoe o arcane_explosion Fluffy_Pillow 52285.3/63371: 83% mana bloodlust, clearcasting, rune_of_power, social_butterfly
0:32.220 aoe o arcane_explosion Fluffy_Pillow 53559.0/63371: 85% mana bloodlust, arcane_charge, rune_of_power, social_butterfly
0:33.227 aoe n shifting_power Fluffy_Pillow 49835.3/63371: 79% mana bloodlust, arcane_charge(2), social_butterfly
0:36.160 aoe o arcane_explosion Fluffy_Pillow 51052.7/63371: 81% mana bloodlust, arcane_charge(2)
0:37.167 aoe o arcane_explosion Fluffy_Pillow 47329.0/63371: 75% mana bloodlust, arcane_charge(3)
0:38.173 aoe p arcane_barrage Fluffy_Pillow 43604.0/63371: 69% mana bloodlust, arcane_charge(4)
0:39.180 aoe m arcane_orb Fluffy_Pillow 47415.2/63371: 75% mana bloodlust
0:40.187 aoe p arcane_barrage Fluffy_Pillow 48191.5/63371: 76% mana bloodlust, arcane_charge(4), social_butterfly
0:41.194 aoe o arcane_explosion Fluffy_Pillow 52002.6/63371: 82% mana social_butterfly
0:42.500 aoe o arcane_explosion Fluffy_Pillow 48657.9/63371: 77% mana arcane_charge, social_butterfly
0:43.804 aoe o arcane_explosion Fluffy_Pillow 45310.6/63371: 72% mana arcane_charge(2), social_butterfly
0:45.110 aoe o arcane_explosion Fluffy_Pillow 41965.9/63371: 66% mana arcane_charge(3), clearcasting
0:46.418 aoe p arcane_barrage Fluffy_Pillow 43623.7/63371: 69% mana arcane_charge(4)
0:47.726 aoe o arcane_explosion Fluffy_Pillow 47816.3/63371: 75% mana
0:49.032 aoe o arcane_explosion Fluffy_Pillow 44471.6/63371: 70% mana arcane_charge
0:50.338 aoe j touch_of_the_magi Fluffy_Pillow 41126.9/63371: 65% mana arcane_charge(2), social_butterfly
0:51.646 aoe l rune_of_power Fluffy_Pillow 40284.7/63371: 64% mana arcane_charge(4), social_butterfly
0:52.954 aoe p arcane_barrage Fluffy_Pillow 41942.5/63371: 66% mana arcane_charge(4), rune_of_power, social_butterfly
0:54.260 aoe o arcane_explosion Fluffy_Pillow 46132.6/63371: 73% mana rune_of_power, social_butterfly
0:55.567 aoe o arcane_explosion Fluffy_Pillow 42789.1/63371: 68% mana arcane_charge, rune_of_power
0:56.875 aoe o arcane_explosion Fluffy_Pillow 39446.9/63371: 62% mana arcane_charge(2), rune_of_power
0:58.182 aoe o arcane_explosion Fluffy_Pillow 36103.4/63371: 57% mana arcane_charge(3), clearcasting, rune_of_power
0:59.488 aoe p arcane_barrage Fluffy_Pillow 37758.7/63371: 60% mana arcane_charge(4), rune_of_power
1:00.795 aoe m arcane_orb Fluffy_Pillow 41950.1/63371: 66% mana rune_of_power, social_butterfly
1:02.102 aoe p arcane_barrage Fluffy_Pillow 43106.6/63371: 68% mana arcane_charge(4), rune_of_power, social_butterfly
1:03.410 aoe o arcane_explosion Fluffy_Pillow 47299.3/63371: 75% mana rune_of_power, social_butterfly
1:04.716 aoe o arcane_explosion Fluffy_Pillow 43954.5/63371: 69% mana arcane_charge, rune_of_power, social_butterfly
1:06.021 aoe o arcane_explosion Fluffy_Pillow 40608.5/63371: 64% mana arcane_charge(2), rune_of_power
1:07.328 aoe o arcane_explosion Fluffy_Pillow 37265.0/63371: 59% mana arcane_charge(3), rune_of_power
1:08.634 aoe p arcane_barrage Fluffy_Pillow 33920.3/63371: 54% mana arcane_charge(4)
1:09.940 aoe o arcane_explosion Fluffy_Pillow 38110.4/63371: 60% mana
1:11.245 aoe o arcane_explosion Fluffy_Pillow 34764.4/63371: 55% mana arcane_charge, social_butterfly
1:12.551 aoe o arcane_explosion Fluffy_Pillow 31419.7/63371: 50% mana arcane_charge(2), clearcasting, social_butterfly
1:13.859 aoe o arcane_explosion Fluffy_Pillow 33077.5/63371: 52% mana arcane_charge(3), social_butterfly
1:15.166 aoe p arcane_barrage Fluffy_Pillow 29734.0/63371: 47% mana arcane_charge(4), clearcasting
1:16.472 aoe o arcane_explosion Fluffy_Pillow 33924.1/63371: 54% mana clearcasting
1:17.779 aoe o arcane_explosion Fluffy_Pillow 35580.7/63371: 56% mana arcane_charge
1:19.088 aoe n shifting_power Fluffy_Pillow 32239.7/63371: 51% mana arcane_charge(2)
1:22.793 aoe o arcane_explosion Fluffy_Pillow 34435.5/63371: 54% mana arcane_charge(2), social_butterfly
1:24.100 aoe o arcane_explosion Fluffy_Pillow 31092.1/63371: 49% mana arcane_charge(3), social_butterfly
1:25.407 aoe p arcane_barrage Fluffy_Pillow 27748.6/63371: 44% mana arcane_charge(4)
1:26.714 aoe m arcane_orb Fluffy_Pillow 31940.0/63371: 50% mana
1:28.021 aoe p arcane_barrage Fluffy_Pillow 33096.5/63371: 52% mana arcane_charge(4)
1:29.327 aoe o arcane_explosion Fluffy_Pillow 37286.6/63371: 59% mana
1:30.632 aoe o arcane_explosion Fluffy_Pillow 33940.6/63371: 54% mana arcane_charge, social_butterfly
1:31.937 aoe o arcane_explosion Fluffy_Pillow 30594.6/63371: 48% mana arcane_charge(2), social_butterfly
1:33.244 aoe o arcane_explosion Fluffy_Pillow 27251.2/63371: 43% mana arcane_charge(3), social_butterfly
1:34.551 aoe p arcane_barrage Fluffy_Pillow 23907.7/63371: 38% mana arcane_charge(4), social_butterfly
1:35.857 aoe o arcane_explosion Fluffy_Pillow 28097.8/63371: 44% mana
1:37.163 aoe j touch_of_the_magi Fluffy_Pillow 24753.1/63371: 39% mana arcane_charge
1:38.470 aoe k arcane_power Fluffy_Pillow 23909.6/63371: 38% mana arcane_charge(4)
1:38.470 aoe p arcane_barrage Fluffy_Pillow 23909.6/63371: 38% mana arcane_charge(4), arcane_power, rune_of_power
1:39.776 aoe o arcane_explosion Fluffy_Pillow 28099.7/63371: 44% mana arcane_power, rune_of_power
1:41.081 aoe o arcane_explosion Fluffy_Pillow 27253.7/63371: 43% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
1:42.388 aoe o arcane_explosion Fluffy_Pillow 26410.2/63371: 42% mana arcane_charge(2), arcane_power, rune_of_power, social_butterfly
1:43.694 aoe o arcane_explosion Fluffy_Pillow 25565.5/63371: 40% mana arcane_charge(3), arcane_power, rune_of_power, social_butterfly
1:45.000 aoe p arcane_barrage Fluffy_Pillow 24720.8/63371: 39% mana arcane_charge(4), arcane_power, rune_of_power
1:46.307 aoe o arcane_explosion Fluffy_Pillow 28912.1/63371: 46% mana arcane_power, rune_of_power
1:47.614 aoe o arcane_explosion Fluffy_Pillow 28068.7/63371: 44% mana arcane_charge, arcane_power, rune_of_power
1:48.922 aoe o arcane_explosion Fluffy_Pillow 27226.5/63371: 43% mana arcane_charge(2), arcane_power, rune_of_power
1:50.229 aoe o arcane_explosion Fluffy_Pillow 26383.0/63371: 42% mana arcane_charge(3), arcane_power, rune_of_power, social_butterfly
1:51.535 aoe p arcane_barrage Fluffy_Pillow 25538.3/63371: 40% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
1:52.844 aoe m arcane_orb Fluffy_Pillow 29732.2/63371: 47% mana arcane_power, rune_of_power, social_butterfly
1:54.149 aoe l rune_of_power Fluffy_Pillow 31136.2/63371: 49% mana arcane_charge(4), social_butterfly
1:55.457 aoe p arcane_barrage Fluffy_Pillow 32794.0/63371: 52% mana arcane_charge(4), rune_of_power
1:56.763 aoe o arcane_explosion Fluffy_Pillow 36984.1/63371: 58% mana rune_of_power
1:58.069 aoe o arcane_explosion Fluffy_Pillow 33639.4/63371: 53% mana arcane_charge, rune_of_power
1:59.375 aoe o arcane_explosion Fluffy_Pillow 30294.6/63371: 48% mana arcane_charge(2), clearcasting, rune_of_power
2:00.683 aoe o arcane_explosion Fluffy_Pillow 31952.4/63371: 50% mana arcane_charge(3), rune_of_power, social_butterfly
2:01.990 aoe p arcane_barrage Fluffy_Pillow 28608.9/63371: 45% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
2:03.296 aoe o arcane_explosion Fluffy_Pillow 32799.1/63371: 52% mana clearcasting, rune_of_power, social_butterfly
2:04.603 aoe o arcane_explosion Fluffy_Pillow 34455.6/63371: 54% mana arcane_charge, rune_of_power, social_butterfly
2:05.910 aoe o arcane_explosion Fluffy_Pillow 31112.1/63371: 49% mana arcane_charge(2), rune_of_power
2:07.216 aoe o arcane_explosion Fluffy_Pillow 27767.4/63371: 44% mana arcane_charge(3), rune_of_power
2:08.522 aoe p arcane_barrage Fluffy_Pillow 24422.6/63371: 39% mana arcane_charge(4), rune_of_power
2:09.828 aoe o arcane_explosion Fluffy_Pillow 28612.8/63371: 45% mana rune_of_power
2:11.132 aoe n shifting_power Fluffy_Pillow 25265.5/63371: 40% mana arcane_charge, social_butterfly
2:14.739 aoe o arcane_explosion Fluffy_Pillow 27337.1/63371: 43% mana arcane_charge, social_butterfly
2:16.045 aoe o arcane_explosion Fluffy_Pillow 23992.4/63371: 38% mana arcane_charge(2), clearcasting
2:17.350 aoe o arcane_explosion Fluffy_Pillow 25646.4/63371: 40% mana arcane_charge(3)
2:18.656 aoe p arcane_barrage Fluffy_Pillow 22301.6/63371: 35% mana arcane_charge(4)
2:19.963 aoe m arcane_orb Fluffy_Pillow 26493.0/63371: 42% mana
2:21.269 aoe p arcane_barrage Fluffy_Pillow 27648.3/63371: 44% mana arcane_charge(4), social_butterfly
2:22.575 aoe o arcane_explosion Fluffy_Pillow 31838.4/63371: 50% mana social_butterfly
2:23.882 shared_cds r use_mana_gem NightFae_Dream_SB 28494.9/63371: 45% mana arcane_charge, social_butterfly
2:23.882 aoe o arcane_explosion Fluffy_Pillow 34832.1/63371: 55% mana arcane_charge, social_butterfly
2:25.188 aoe o arcane_explosion Fluffy_Pillow 31487.3/63371: 50% mana arcane_charge(2)
2:26.495 aoe o arcane_explosion Fluffy_Pillow 28143.8/63371: 44% mana arcane_charge(3)
2:27.800 aoe p arcane_barrage Fluffy_Pillow 24797.8/63371: 39% mana arcane_charge(4)
2:29.108 aoe j touch_of_the_magi Fluffy_Pillow 28990.5/63371: 46% mana
2:30.413 aoe l rune_of_power Fluffy_Pillow 28144.5/63371: 44% mana arcane_charge(4), social_butterfly
2:31.720 aoe p arcane_barrage Fluffy_Pillow 29801.0/63371: 47% mana arcane_charge(4), rune_of_power, social_butterfly
2:33.026 aoe o arcane_explosion Fluffy_Pillow 33991.1/63371: 54% mana rune_of_power, social_butterfly
2:34.332 aoe o arcane_explosion Fluffy_Pillow 30646.4/63371: 48% mana arcane_charge, clearcasting, rune_of_power, social_butterfly
2:35.637 aoe o arcane_explosion Fluffy_Pillow 32300.4/63371: 51% mana arcane_charge(2), rune_of_power
2:36.942 aoe o arcane_explosion Fluffy_Pillow 28954.4/63371: 46% mana arcane_charge(3), rune_of_power
2:38.250 aoe p arcane_barrage Fluffy_Pillow 25612.2/63371: 40% mana arcane_charge(4), rune_of_power
2:39.556 aoe o arcane_explosion Fluffy_Pillow 29802.3/63371: 47% mana rune_of_power
2:40.862 aoe o arcane_explosion Fluffy_Pillow 26457.6/63371: 42% mana arcane_charge, rune_of_power, social_butterfly
2:42.168 aoe o arcane_explosion Fluffy_Pillow 23112.8/63371: 36% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly
2:43.477 aoe o arcane_explosion Fluffy_Pillow 24771.9/63371: 39% mana arcane_charge(3), rune_of_power, social_butterfly
2:44.783 aoe p arcane_barrage Fluffy_Pillow 21427.2/63371: 34% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
2:46.089 aoe m arcane_orb Fluffy_Pillow 25617.3/63371: 40% mana clearcasting, rune_of_power
2:47.395 aoe p arcane_barrage Fluffy_Pillow 26772.5/63371: 42% mana arcane_charge(4), clearcasting(2)
2:48.700 aoe o arcane_explosion Fluffy_Pillow 30961.4/63371: 49% mana clearcasting(2)
2:50.005 aoe o arcane_explosion Fluffy_Pillow 32615.4/63371: 51% mana arcane_charge, clearcasting, social_butterfly
2:51.309 aoe o arcane_explosion Fluffy_Pillow 34268.1/63371: 54% mana arcane_charge(2), social_butterfly
2:52.615 aoe o arcane_explosion Fluffy_Pillow 30923.4/63371: 49% mana arcane_charge(3), social_butterfly
2:53.921 aoe p arcane_barrage Fluffy_Pillow 27578.6/63371: 44% mana arcane_charge(4), social_butterfly
2:55.230 aoe o arcane_explosion Fluffy_Pillow 31772.6/63371: 50% mana
2:56.536 aoe n shifting_power Fluffy_Pillow 28427.8/63371: 45% mana arcane_charge, clearcasting
3:00.219 aoe o arcane_explosion Fluffy_Pillow 30595.8/63371: 48% mana arcane_charge, clearcasting(2), social_butterfly
3:01.525 aoe o arcane_explosion Fluffy_Pillow 32251.0/63371: 51% mana arcane_charge(2), clearcasting, social_butterfly
3:02.830 aoe o arcane_explosion Fluffy_Pillow 33905.0/63371: 54% mana arcane_charge(3), social_butterfly
3:04.137 aoe p arcane_barrage Fluffy_Pillow 30561.5/63371: 48% mana arcane_charge(4), social_butterfly
3:05.443 aoe m arcane_orb Fluffy_Pillow 34751.7/63371: 55% mana
3:06.748 aoe p arcane_barrage Fluffy_Pillow 35905.7/63371: 57% mana arcane_charge(4)
3:08.055 aoe o arcane_explosion Fluffy_Pillow 40097.0/63371: 63% mana
3:09.363 aoe o arcane_explosion Fluffy_Pillow 36754.8/63371: 58% mana arcane_charge
3:10.669 aoe o arcane_explosion Fluffy_Pillow 33410.1/63371: 53% mana arcane_charge(2), social_butterfly
3:11.975 aoe o arcane_explosion Fluffy_Pillow 30065.4/63371: 47% mana arcane_charge(3), clearcasting, social_butterfly
3:13.284 aoe p arcane_barrage Fluffy_Pillow 31724.4/63371: 50% mana arcane_charge(4), social_butterfly
3:14.590 aoe j touch_of_the_magi Fluffy_Pillow 35914.5/63371: 57% mana social_butterfly
3:15.896 aoe k arcane_power Fluffy_Pillow 35069.8/63371: 55% mana arcane_charge(4)
3:15.896 shared_cds t berserking Fluffy_Pillow 35069.8/63371: 55% mana arcane_charge(4), arcane_power, rune_of_power
3:15.896 aoe p arcane_barrage Fluffy_Pillow 35069.8/63371: 55% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.087 aoe o arcane_explosion Fluffy_Pillow 39114.2/63371: 62% mana berserking, arcane_power, rune_of_power
3:18.276 aoe o arcane_explosion Fluffy_Pillow 38121.1/63371: 60% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power
3:19.466 aoe o arcane_explosion Fluffy_Pillow 39629.4/63371: 63% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.654 aoe o arcane_explosion Fluffy_Pillow 38635.1/63371: 61% mana berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly
3:21.842 aoe p arcane_barrage Fluffy_Pillow 37640.8/63371: 59% mana berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
3:23.030 aoe o arcane_explosion Fluffy_Pillow 41681.4/63371: 66% mana berserking, arcane_power, rune_of_power, social_butterfly
3:24.217 aoe o arcane_explosion Fluffy_Pillow 40685.8/63371: 64% mana berserking, arcane_charge, arcane_power, rune_of_power, social_butterfly
3:25.404 aoe o arcane_explosion Fluffy_Pillow 39690.2/63371: 63% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:26.594 aoe o arcane_explosion Fluffy_Pillow 38698.5/63371: 61% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:27.783 aoe p arcane_barrage Fluffy_Pillow 37705.4/63371: 59% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:28.972 aoe m arcane_orb Fluffy_Pillow 41747.3/63371: 66% mana arcane_power, rune_of_power
3:30.278 aoe p arcane_barrage Fluffy_Pillow 43152.5/63371: 68% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
3:31.683 aoe o arcane_explosion Fluffy_Pillow 47468.1/63371: 75% mana social_butterfly
3:32.989 aoe o arcane_explosion Fluffy_Pillow 44123.4/63371: 70% mana arcane_charge, social_butterfly
3:34.293 aoe o arcane_explosion Fluffy_Pillow 40776.1/63371: 64% mana arcane_charge(2), social_butterfly
3:35.600 aoe o arcane_explosion Fluffy_Pillow 37432.6/63371: 59% mana arcane_charge(3), clearcasting
3:36.908 aoe l rune_of_power Fluffy_Pillow 39090.4/63371: 62% mana arcane_charge(4)
3:38.216 aoe p arcane_barrage Fluffy_Pillow 40748.2/63371: 64% mana arcane_charge(4), rune_of_power
3:39.520 aoe o arcane_explosion Fluffy_Pillow 44935.8/63371: 71% mana rune_of_power
3:40.826 aoe o arcane_explosion Fluffy_Pillow 41591.1/63371: 66% mana arcane_charge, clearcasting, rune_of_power, social_butterfly
3:42.132 aoe o arcane_explosion Fluffy_Pillow 43246.3/63371: 68% mana arcane_charge(2), rune_of_power, social_butterfly
3:43.441 aoe o arcane_explosion Fluffy_Pillow 39905.4/63371: 63% mana arcane_charge(3), rune_of_power, social_butterfly
3:44.746 aoe p arcane_barrage Fluffy_Pillow 36559.4/63371: 58% mana arcane_charge(4), rune_of_power, social_butterfly
3:46.053 aoe o arcane_explosion Fluffy_Pillow 40750.8/63371: 64% mana rune_of_power
3:47.359 aoe o arcane_explosion Fluffy_Pillow 37406.0/63371: 59% mana arcane_charge, rune_of_power
3:48.664 aoe o arcane_explosion Fluffy_Pillow 34060.0/63371: 54% mana arcane_charge(2), rune_of_power
3:49.970 aoe o arcane_explosion Fluffy_Pillow 30715.3/63371: 48% mana arcane_charge(3), rune_of_power
3:51.276 aoe p arcane_barrage Fluffy_Pillow 27370.6/63371: 43% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
3:52.583 aoe m arcane_orb Fluffy_Pillow 31562.0/63371: 50% mana clearcasting, rune_of_power, social_butterfly
3:53.890 aoe n shifting_power Fluffy_Pillow 32718.5/63371: 52% mana arcane_charge(4), clearcasting, social_butterfly
3:57.507 aoe p arcane_barrage Fluffy_Pillow 34802.8/63371: 55% mana arcane_charge(4), clearcasting(2)
3:58.814 aoe o arcane_explosion Fluffy_Pillow 38994.2/63371: 62% mana clearcasting(2)
4:00.122 aoe o arcane_explosion Fluffy_Pillow 40652.0/63371: 64% mana arcane_charge, clearcasting, social_butterfly
4:01.431 aoe o arcane_explosion Fluffy_Pillow 42311.0/63371: 67% mana arcane_charge(2), social_butterfly
4:02.737 aoe o arcane_explosion Fluffy_Pillow 38966.3/63371: 61% mana arcane_charge(3), social_butterfly
4:04.044 aoe p arcane_barrage Fluffy_Pillow 35622.8/63371: 56% mana arcane_charge(4), social_butterfly
4:05.353 aoe m arcane_orb Fluffy_Pillow 39816.7/63371: 63% mana
4:06.659 aoe p arcane_barrage Fluffy_Pillow 40972.0/63371: 65% mana arcane_charge(4)
4:07.965 aoe o arcane_explosion Fluffy_Pillow 45162.1/63371: 71% mana
4:09.271 aoe o arcane_explosion Fluffy_Pillow 41817.4/63371: 66% mana arcane_charge
4:10.578 aoe j touch_of_the_magi Fluffy_Pillow 38473.9/63371: 61% mana arcane_charge(2), social_butterfly
4:11.884 aoe l rune_of_power Fluffy_Pillow 37629.2/63371: 59% mana arcane_charge(4), social_butterfly
4:13.189 aoe p arcane_barrage Fluffy_Pillow 39283.2/63371: 62% mana arcane_charge(4), rune_of_power, social_butterfly
4:14.495 aoe o arcane_explosion Fluffy_Pillow 43473.3/63371: 69% mana rune_of_power, social_butterfly
4:15.802 aoe o arcane_explosion Fluffy_Pillow 40129.8/63371: 63% mana arcane_charge, rune_of_power
4:17.108 aoe o arcane_explosion Fluffy_Pillow 36785.1/63371: 58% mana arcane_charge(2), clearcasting, rune_of_power
4:18.416 aoe o arcane_explosion Fluffy_Pillow 38442.9/63371: 61% mana arcane_charge(3), rune_of_power
4:19.722 aoe p arcane_barrage Fluffy_Pillow 35098.1/63371: 55% mana arcane_charge(4), rune_of_power
4:21.029 aoe o arcane_explosion Fluffy_Pillow 39289.5/63371: 62% mana rune_of_power, social_butterfly
4:22.338 aoe o arcane_explosion Fluffy_Pillow 35948.6/63371: 57% mana arcane_charge, rune_of_power, social_butterfly
4:23.645 shared_cds r use_mana_gem NightFae_Dream_SB 32605.1/63371: 51% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly
4:23.882 aoe o arcane_explosion Fluffy_Pillow 39242.6/63371: 62% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly
4:25.190 aoe o arcane_explosion Fluffy_Pillow 40900.4/63371: 65% mana arcane_charge(3), rune_of_power
4:26.497 aoe p arcane_barrage Fluffy_Pillow 37557.0/63371: 59% mana arcane_charge(4), rune_of_power
4:27.802 aoe m arcane_orb Fluffy_Pillow 41745.8/63371: 66% mana rune_of_power
4:29.108 aoe p arcane_barrage Fluffy_Pillow 42901.1/63371: 68% mana arcane_charge(4)
4:30.415 aoe o arcane_explosion Fluffy_Pillow 47092.5/63371: 74% mana social_butterfly
4:31.722 aoe o arcane_explosion Fluffy_Pillow 43749.0/63371: 69% mana arcane_charge, social_butterfly
4:33.027 aoe o arcane_explosion Fluffy_Pillow 40403.0/63371: 64% mana arcane_charge(2), social_butterfly
4:34.333 aoe o arcane_explosion Fluffy_Pillow 37058.2/63371: 58% mana arcane_charge(3), social_butterfly
4:35.638 aoe p arcane_barrage Fluffy_Pillow 33712.2/63371: 53% mana arcane_charge(4), clearcasting
4:36.944 aoe o arcane_explosion Fluffy_Pillow 37902.4/63371: 60% mana clearcasting
4:38.250 aoe o arcane_explosion Fluffy_Pillow 39557.6/63371: 62% mana arcane_charge
4:39.557 aoe n shifting_power Fluffy_Pillow 36214.1/63371: 57% mana arcane_charge(2), clearcasting
4:43.277 aoe o arcane_explosion Fluffy_Pillow 38429.0/63371: 61% mana arcane_charge(2), clearcasting, social_butterfly
4:44.584 aoe o arcane_explosion Fluffy_Pillow 40085.5/63371: 63% mana arcane_charge(3), social_butterfly
4:45.893 aoe p arcane_barrage Fluffy_Pillow 36744.6/63371: 58% mana arcane_charge(4)
4:47.199 aoe m arcane_orb Fluffy_Pillow 40934.7/63371: 65% mana
4:48.505 aoe p arcane_barrage Fluffy_Pillow 42090.0/63371: 66% mana arcane_charge(4), clearcasting
4:49.812 aoe o arcane_explosion Fluffy_Pillow 46281.3/63371: 73% mana clearcasting
4:51.117 aoe j touch_of_the_magi Fluffy_Pillow 47935.3/63371: 76% mana arcane_charge, social_butterfly
4:52.423 aoe k arcane_power Fluffy_Pillow 47090.6/63371: 74% mana arcane_charge(4), social_butterfly
4:52.423 aoe p arcane_barrage Fluffy_Pillow 47090.6/63371: 74% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
4:53.729 aoe o arcane_explosion Fluffy_Pillow 51280.7/63371: 81% mana arcane_power, rune_of_power, social_butterfly
4:55.037 aoe o arcane_explosion Fluffy_Pillow 50438.5/63371: 80% mana arcane_charge, arcane_power, rune_of_power
4:56.344 aoe o arcane_explosion Fluffy_Pillow 49595.0/63371: 78% mana arcane_charge(2), arcane_power, rune_of_power
4:57.651 aoe o arcane_explosion Fluffy_Pillow 48751.6/63371: 77% mana arcane_charge(3), arcane_power, rune_of_power
4:58.958 aoe p arcane_barrage Fluffy_Pillow 47908.1/63371: 76% mana arcane_charge(4), arcane_power, rune_of_power
5:00.265 aoe o arcane_explosion Fluffy_Pillow 52099.5/63371: 82% mana arcane_power, rune_of_power, social_butterfly
5:01.574 shared_cds s potion Fluffy_Pillow 51258.5/63371: 81% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
5:01.574 aoe o arcane_explosion Fluffy_Pillow 51258.5/63371: 81% mana arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:02.880 aoe o arcane_explosion Fluffy_Pillow 50413.8/63371: 80% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:04.187 aoe o arcane_explosion Fluffy_Pillow 52070.3/63371: 82% mana arcane_charge(3), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:05.493 aoe p arcane_barrage Fluffy_Pillow 51225.6/63371: 81% mana arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
5:06.798 aoe o arcane_explosion Fluffy_Pillow 55414.5/63371: 87% mana arcane_power, rune_of_power, potion_of_deathly_fixation
5:08.104 aoe o arcane_explosion Fluffy_Pillow 54569.7/63371: 86% mana arcane_charge, clearcasting, potion_of_deathly_fixation
5:09.410 aoe o arcane_explosion Fluffy_Pillow 56225.0/63371: 89% mana arcane_charge(2), potion_of_deathly_fixation
5:10.718 aoe o arcane_explosion Fluffy_Pillow 52882.8/63371: 83% mana arcane_charge(3), social_butterfly, potion_of_deathly_fixation
5:12.025 aoe l rune_of_power Fluffy_Pillow 49539.3/63371: 78% mana arcane_charge(4), social_butterfly, potion_of_deathly_fixation
5:13.331 aoe p arcane_barrage Fluffy_Pillow 51194.6/63371: 81% mana arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:14.638 aoe m arcane_orb Fluffy_Pillow 55385.9/63371: 87% mana rune_of_power, social_butterfly, potion_of_deathly_fixation
5:15.943 aoe p arcane_barrage Fluffy_Pillow 56539.9/63371: 89% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:17.249 aoe o arcane_explosion Fluffy_Pillow 60730.1/63371: 96% mana rune_of_power, potion_of_deathly_fixation
5:18.554 aoe o arcane_explosion Fluffy_Pillow 57384.1/63371: 91% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:19.860 aoe o arcane_explosion Fluffy_Pillow 54039.3/63371: 85% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:21.165 aoe o arcane_explosion Fluffy_Pillow 50693.3/63371: 80% mana arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:22.470 aoe p arcane_barrage Fluffy_Pillow 47347.3/63371: 75% mana arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:23.776 aoe o arcane_explosion Fluffy_Pillow 51537.4/63371: 81% mana rune_of_power, social_butterfly, potion_of_deathly_fixation
5:25.081 aoe o arcane_explosion Fluffy_Pillow 48191.4/63371: 76% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:26.387 aoe o arcane_explosion Fluffy_Pillow 44846.7/63371: 71% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:27.693 aoe o arcane_explosion Fluffy_Pillow 41501.9/63371: 65% mana arcane_charge(3), rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream_SB"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=319210//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Koraylon : 11506 dps, 4856 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11505.5 11505.5 15.9 / 0.138% 1038.3 / 9.0% 6.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
1887.8 1785.8 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Koraylon 11506
Arcane Barrage 4122 35.8% 54.3 5.55sec 22769 18392 Direct 162.8 6361 12809 7605 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.34 162.79 0.00 0.00 1.2380 0.0000 1237386.43 1237386.43 0.00% 18392.14 18392.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 131.39 93 167 6361.28 2082 25140 6365.25 5383 6966 835613 835613 0.00%
crit 19.29% 31.40 15 55 12809.32 4164 50280 12803.54 7793 21583 401774 401774 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.35
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 299 2.6% 41.4 6.89sec 2168 0 Direct 124.3 606 1212 723 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.42 124.26 0.00 0.00 0.0000 0.0000 89814.23 89814.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 100.27 69 131 605.86 443 731 606.15 580 643 60744 60744 0.00%
crit 19.31% 23.99 9 41 1211.68 886 1462 1212.49 1045 1391 29070 29070 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4798 41.7% 142.9 2.08sec 10089 8112 Direct 428.7 2820 5641 3363 19.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.89 428.67 0.00 0.00 1.2437 0.0000 1441555.77 1441555.77 0.00% 8111.66 8111.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 346.22 268 423 2820.00 1958 4523 2819.90 2725 2911 976332 976332 0.00%
crit 19.23% 82.45 49 130 5641.32 3916 9045 5642.60 5018 6249 465223 465223 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.87
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (911) 0.0% (7.9%) 13.9 22.31sec 19674 15933

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.88 0.00 0.00 0.00 1.2349 0.0000 0.00 0.00 0.00% 15933.09 15933.09

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.89
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 911 7.9% 41.6 22.32sec 6569 0 Direct 41.6 5493 11056 6568 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.58 41.58 0.00 0.00 0.0000 0.0000 273156.95 273156.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 33.55 22 47 5493.02 3869 8938 5502.76 4902 6090 184273 184273 0.00%
crit 19.33% 8.04 1 19 11056.11 7739 17876 11095.98 7739 17876 88884 88884 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (91) 0.0% (0.8%) 18.6 9.14sec 1490 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.64 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 91 0.8% 18.6 9.14sec 1490 0 Direct 18.6 1253 2507 1491 18.9%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.64 18.64 0.00 0.00 0.0000 0.0000 27781.88 27781.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 15.12 5 29 1253.37 1164 1280 1259.20 1205 1280 18944 18944 0.00%
crit 18.91% 3.53 0 11 2506.85 2327 2560 2448.43 0 2560 8838 8838 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1629 3257 1920 18.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1921.31 1921.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.04% 0.82 0 1 1628.74 1629 1629 1336.18 0 1629 1336 1336 0.00%
crit 17.96% 0.18 0 1 3257.49 3257 3257 585.13 0 3257 585 585 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6038 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6038.22 6038.22 0.00% 51.27 51.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 72.60 61 82 56.23 43 60 56.23 55 58 4082 4082 0.00%
crit 19.34% 17.40 8 29 112.39 86 120 112.39 101 120 1956 1956 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 394 3.4% 6.0 49.53sec 19948 5595 Periodic 70.9 1402 2806 1673 19.3% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 0.00 23.64 70.92 3.5656 0.8342 118705.48 118705.48 0.00% 5594.56 5594.56
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 57.21 37 79 1402.40 1372 1510 1401.94 1382 1426 80230 80230 0.00%
crit 19.33% 13.71 4 26 2805.73 2745 3019 2804.72 2745 2909 38475 38475 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.95
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (864) 0.0% (7.5%) 6.6 49.18sec 39400 30158

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.58 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 30158.24 30158.24

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.62
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 864 7.5% 6.6 49.08sec 39400 0 Direct 19.6 13226 0 13226 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.58 19.64 0.00 0.00 0.0000 0.0000 259391.01 259391.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.64 15 24 13225.82 3377 48579 13240.43 10755 16579 259391 259391 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27741.92
  • base_dd_max:27741.92
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Koraylon
Arcane Power 3.6 97.24sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.58
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.78sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.3 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.25 0.00 1.50 0.00 4.2710 0.7213 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.25
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.47sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 48.00sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.38 0.00 0.00 0.00 1.2595 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.41
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.64sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.80
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.1 149.8 5.5sec 1.5sec 4.2sec 76.32% 0.00% 3.5 (5.4) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 9.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • arcane_charge_1:21.33%
  • arcane_charge_2:18.95%
  • arcane_charge_3:14.47%
  • arcane_charge_4:21.57%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.09% 23.63% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.7s / 199.3s
  • trigger_min/max:192.7s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.09%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.4 0.2 13.0sec 12.9sec 2.2sec 16.39% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.17%
  • clearcasting_2:0.23%
  • clearcasting_3:0.05%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.3 0.0 0.0sec 0.0sec 4.3sec 0.36% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:0.37%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.3sec 11.32% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.32%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.5sec 31.5sec 14.6sec 48.43% 0.00% 0.0 (0.0) 9.5

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.7s
  • trigger_min/max:16.8s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.43%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.55% 0.76% 5.58% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.737144.053263.903
Evocation224.39993.023353.908286.530174.563359.846
Rune of Power14.2570.02836.57194.12776.465111.867
Touch of the Magi10.8770.00017.39773.90057.15193.025
Arcane Power1.2380.0046.1164.4402.0629.007
Arcane Barrage3.0400.00012.205166.589132.481202.211
Arcane Orb4.6080.00013.26364.52248.14281.076
Shifting Power9.3390.00033.25455.67250.01663.590

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Koraylon
mana_regen Mana 686.21 373688.54 69.58% 544.57 6927.23 1.82%
Evocation Mana 11.98 12049.56 2.24% 1005.61 0.00 0.00%
Mana Gem Mana 2.80 17755.17 3.31% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.35 133576.34 24.87% 2457.60 4199.29 3.05%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1785.82 1887.76 11143.1 32713.7 1191.9 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Koraylon
arcane_explosion Mana 142.9 529149.8 3703.7 3703.2 2.7
arcane_orb Mana 13.9 6190.7 445.9 445.9 44.1
shifting_power Mana 6.0 14878.9 2500.0 2500.3 8.0
touch_of_the_magi Mana 6.6 16473.6 2500.0 2502.2 15.7

Statistics & Data Analysis

Fight Length
NightFae_Koraylon Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Koraylon Damage Per Second
Count 1119
Mean 11505.54
Minimum 10796.01
Maximum 12441.00
Spread ( max - min ) 1644.98
Range [ ( max - min ) / 2 * 100% ] 7.15%
Standard Deviation 271.7200
5th Percentile 11077.17
95th Percentile 11985.93
( 95th Percentile - 5th Percentile ) 908.76
Mean Distribution
Standard Deviation 8.1228
95.00% Confidence Interval ( 11489.62 - 11521.46 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2143
0.1 Scale Factor Error with Delta=300 631
0.05 Scale Factor Error with Delta=300 2522
0.01 Scale Factor Error with Delta=300 63028
Priority Target DPS
NightFae_Koraylon Priority Target Damage Per Second
Count 1119
Mean 4856.18
Minimum 4411.84
Maximum 5544.99
Spread ( max - min ) 1133.15
Range [ ( max - min ) / 2 * 100% ] 11.67%
Standard Deviation 172.4341
5th Percentile 4592.96
95th Percentile 5144.68
( 95th Percentile - 5th Percentile ) 551.72
Mean Distribution
Standard Deviation 5.1548
95.00% Confidence Interval ( 4846.08 - 4866.29 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4844
0.1 Scale Factor Error with Delta=300 254
0.05 Scale Factor Error with Delta=300 1016
0.01 Scale Factor Error with Delta=300 25383
DPS(e)
NightFae_Koraylon Damage Per Second (Effective)
Count 1119
Mean 11505.54
Minimum 10796.01
Maximum 12441.00
Spread ( max - min ) 1644.98
Range [ ( max - min ) / 2 * 100% ] 7.15%
Damage
NightFae_Koraylon Damage
Count 1119
Mean 3449713.05
Minimum 2701408.71
Maximum 4131392.74
Spread ( max - min ) 1429984.03
Range [ ( max - min ) / 2 * 100% ] 20.73%
DTPS
NightFae_Koraylon Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Koraylon Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Koraylon Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Koraylon Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Koraylon Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Koraylon Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_KoraylonTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Koraylon Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.62 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.58 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.41 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.89 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.95 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.87 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.35 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.25 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.80 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmporooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpoooopooroopmpoooopoonoopmpojkpooooposooopoooolpmpoooopoooo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Koraylon 63371.4/63371: 100% mana
Pre precombat R food NightFae_Koraylon 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4)
0:01.306 shared_cds s potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.306 shared_cds t berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.306 aoe p arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.220 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.134 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.049 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.963 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.877 aoe o arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.791 aoe o arcane_explosion Fluffy_Pillow 59346.7/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:07.705 aoe p arcane_barrage Fluffy_Pillow 60505.1/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.619 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.535 aoe o arcane_explosion Fluffy_Pillow 62032.4/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.448 aoe o arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.363 aoe o arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:12.277 aoe p arcane_barrage Fluffy_Pillow 60507.7/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.193 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.108 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.114 aoe o arcane_explosion Fluffy_Pillow 60806.2/63371: 96% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.119 aoe o arcane_explosion Fluffy_Pillow 59579.9/63371: 94% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:17.124 aoe l rune_of_power Fluffy_Pillow 60853.7/63371: 96% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.132 aoe p arcane_barrage Fluffy_Pillow 62131.3/63371: 98% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.138 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.146 aoe o arcane_explosion Fluffy_Pillow 59649.0/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
0:21.152 aoe o arcane_explosion Fluffy_Pillow 60924.0/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.158 aoe o arcane_explosion Fluffy_Pillow 57199.1/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.164 shared_cds r use_mana_gem NightFae_Koraylon 53474.1/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:23.164 aoe p arcane_barrage Fluffy_Pillow 59811.2/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.170 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.177 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.184 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.193 aoe o arcane_explosion Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.198 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:29.203 aoe o arcane_explosion Fluffy_Pillow 52197.8/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:30.210 aoe p arcane_barrage Fluffy_Pillow 48474.1/63371: 76% mana bloodlust, arcane_charge(4), rune_of_power
0:31.216 aoe o arcane_explosion Fluffy_Pillow 52284.0/63371: 83% mana bloodlust, rune_of_power
0:32.223 aoe o arcane_explosion Fluffy_Pillow 48560.3/63371: 77% mana bloodlust, arcane_charge, rune_of_power
0:33.229 aoe n shifting_power Fluffy_Pillow 44835.3/63371: 71% mana bloodlust, arcane_charge(2), clearcasting
0:36.186 aoe o arcane_explosion Fluffy_Pillow 46083.1/63371: 73% mana bloodlust, arcane_charge(2), clearcasting
0:37.193 aoe o arcane_explosion Fluffy_Pillow 47359.4/63371: 75% mana bloodlust, arcane_charge(3)
0:38.201 aoe p arcane_barrage Fluffy_Pillow 43637.0/63371: 69% mana bloodlust, arcane_charge(4)
0:39.208 aoe m arcane_orb Fluffy_Pillow 47448.1/63371: 75% mana bloodlust
0:40.213 aoe p arcane_barrage Fluffy_Pillow 48221.9/63371: 76% mana bloodlust, arcane_charge(4)
0:41.216 aoe o arcane_explosion Fluffy_Pillow 52028.0/63371: 82% mana
0:42.523 aoe o arcane_explosion Fluffy_Pillow 48684.5/63371: 77% mana arcane_charge
0:43.829 aoe o arcane_explosion Fluffy_Pillow 45339.8/63371: 72% mana arcane_charge(2)
0:45.136 aoe o arcane_explosion Fluffy_Pillow 41996.3/63371: 66% mana arcane_charge(3)
0:46.442 aoe p arcane_barrage Fluffy_Pillow 38651.6/63371: 61% mana arcane_charge(4)
0:47.748 aoe o arcane_explosion Fluffy_Pillow 42841.7/63371: 68% mana
0:49.054 aoe o arcane_explosion Fluffy_Pillow 39496.9/63371: 62% mana arcane_charge, clearcasting
0:50.361 aoe j touch_of_the_magi Fluffy_Pillow 41153.5/63371: 65% mana arcane_charge(2)
0:51.668 aoe l rune_of_power Fluffy_Pillow 40310.0/63371: 64% mana arcane_charge(4)
0:52.974 aoe p arcane_barrage Fluffy_Pillow 41965.3/63371: 66% mana arcane_charge(4), rune_of_power
0:54.280 aoe o arcane_explosion Fluffy_Pillow 46155.4/63371: 73% mana rune_of_power
0:55.587 aoe o arcane_explosion Fluffy_Pillow 42811.9/63371: 68% mana arcane_charge, rune_of_power
0:56.893 aoe o arcane_explosion Fluffy_Pillow 39467.2/63371: 62% mana arcane_charge(2), rune_of_power
0:58.199 aoe o arcane_explosion Fluffy_Pillow 36122.4/63371: 57% mana arcane_charge(3), rune_of_power
0:59.504 aoe p arcane_barrage Fluffy_Pillow 32776.4/63371: 52% mana arcane_charge(4), clearcasting, rune_of_power
1:00.813 aoe m arcane_orb Fluffy_Pillow 36970.4/63371: 58% mana clearcasting, rune_of_power
1:02.119 aoe p arcane_barrage Fluffy_Pillow 38125.6/63371: 60% mana arcane_charge(4), clearcasting, rune_of_power
1:03.425 aoe o arcane_explosion Fluffy_Pillow 42315.7/63371: 67% mana clearcasting, rune_of_power
1:04.732 aoe o arcane_explosion Fluffy_Pillow 43972.3/63371: 69% mana arcane_charge, rune_of_power
1:06.038 aoe o arcane_explosion Fluffy_Pillow 40627.5/63371: 64% mana arcane_charge(2), clearcasting, rune_of_power
1:07.346 aoe o arcane_explosion Fluffy_Pillow 42285.3/63371: 67% mana arcane_charge(3), rune_of_power
1:08.654 aoe p arcane_barrage Fluffy_Pillow 38943.1/63371: 61% mana arcane_charge(4)
1:09.961 aoe o arcane_explosion Fluffy_Pillow 43134.5/63371: 68% mana
1:11.268 aoe o arcane_explosion Fluffy_Pillow 39791.0/63371: 63% mana arcane_charge
1:12.574 aoe o arcane_explosion Fluffy_Pillow 36446.3/63371: 58% mana arcane_charge(2)
1:13.881 aoe o arcane_explosion Fluffy_Pillow 33102.8/63371: 52% mana arcane_charge(3)
1:15.189 aoe p arcane_barrage Fluffy_Pillow 29760.6/63371: 47% mana arcane_charge(4)
1:16.494 aoe o arcane_explosion Fluffy_Pillow 33949.5/63371: 54% mana
1:17.801 aoe o arcane_explosion Fluffy_Pillow 30606.0/63371: 48% mana arcane_charge
1:19.107 aoe n shifting_power Fluffy_Pillow 27261.3/63371: 43% mana arcane_charge(2)
1:22.838 aoe o arcane_explosion Fluffy_Pillow 29490.0/63371: 47% mana arcane_charge(2)
1:24.146 aoe o arcane_explosion Fluffy_Pillow 26147.8/63371: 41% mana arcane_charge(3)
1:25.452 aoe p arcane_barrage Fluffy_Pillow 22803.1/63371: 36% mana arcane_charge(4)
1:26.758 aoe m arcane_orb Fluffy_Pillow 26993.2/63371: 43% mana
1:28.064 aoe p arcane_barrage Fluffy_Pillow 28148.5/63371: 44% mana arcane_charge(4)
1:29.370 aoe o arcane_explosion Fluffy_Pillow 32338.6/63371: 51% mana
1:30.676 aoe o arcane_explosion Fluffy_Pillow 28993.9/63371: 46% mana arcane_charge
1:31.983 aoe o arcane_explosion Fluffy_Pillow 25650.4/63371: 40% mana arcane_charge(2)
1:33.289 aoe o arcane_explosion Fluffy_Pillow 22305.7/63371: 35% mana arcane_charge(3)
1:34.595 aoe p arcane_barrage Fluffy_Pillow 18960.9/63371: 30% mana arcane_charge(4)
1:35.901 aoe o arcane_explosion Fluffy_Pillow 23151.0/63371: 37% mana
1:37.208 aoe j touch_of_the_magi Fluffy_Pillow 19807.6/63371: 31% mana arcane_charge, clearcasting
1:38.514 aoe k arcane_power Fluffy_Pillow 18962.8/63371: 30% mana arcane_charge(4), clearcasting
1:38.514 aoe p arcane_barrage Fluffy_Pillow 18962.8/63371: 30% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
1:39.819 aoe o arcane_explosion Fluffy_Pillow 23151.7/63371: 37% mana arcane_power, clearcasting, rune_of_power
1:41.125 aoe o arcane_explosion Fluffy_Pillow 24806.9/63371: 39% mana arcane_charge, arcane_power, rune_of_power
1:42.431 aoe o arcane_explosion Fluffy_Pillow 23962.2/63371: 38% mana arcane_charge(2), arcane_power, rune_of_power
1:43.738 aoe o arcane_explosion Fluffy_Pillow 23118.7/63371: 36% mana arcane_charge(3), arcane_power, rune_of_power
1:45.045 aoe p arcane_barrage Fluffy_Pillow 22275.3/63371: 35% mana arcane_charge(4), arcane_power, rune_of_power
1:46.351 aoe o arcane_explosion Fluffy_Pillow 26465.4/63371: 42% mana arcane_power, rune_of_power
1:47.658 aoe o arcane_explosion Fluffy_Pillow 25621.9/63371: 40% mana arcane_charge, arcane_power, clearcasting, rune_of_power
1:48.964 aoe o arcane_explosion Fluffy_Pillow 27277.2/63371: 43% mana arcane_charge(2), arcane_power, rune_of_power
1:50.271 aoe o arcane_explosion Fluffy_Pillow 26433.7/63371: 42% mana arcane_charge(3), arcane_power, rune_of_power
1:51.580 aoe p arcane_barrage Fluffy_Pillow 25592.8/63371: 40% mana arcane_charge(4), arcane_power, rune_of_power
1:52.887 aoe m arcane_orb Fluffy_Pillow 29784.1/63371: 47% mana arcane_power, rune_of_power
1:54.193 aoe l rune_of_power Fluffy_Pillow 31189.4/63371: 49% mana arcane_charge(4)
1:55.499 aoe p arcane_barrage Fluffy_Pillow 32844.7/63371: 52% mana arcane_charge(4), rune_of_power
1:56.807 aoe o arcane_explosion Fluffy_Pillow 37037.3/63371: 58% mana rune_of_power
1:58.114 aoe o arcane_explosion Fluffy_Pillow 33693.9/63371: 53% mana arcane_charge, rune_of_power
1:59.418 aoe o arcane_explosion Fluffy_Pillow 30346.6/63371: 48% mana arcane_charge(2), rune_of_power
2:00.725 aoe o arcane_explosion Fluffy_Pillow 27003.1/63371: 43% mana arcane_charge(3), rune_of_power
2:02.031 aoe p arcane_barrage Fluffy_Pillow 23658.4/63371: 37% mana arcane_charge(4), rune_of_power
2:03.336 aoe o arcane_explosion Fluffy_Pillow 27847.2/63371: 44% mana rune_of_power
2:04.643 aoe o arcane_explosion Fluffy_Pillow 24503.7/63371: 39% mana arcane_charge, rune_of_power
2:05.950 aoe o arcane_explosion Fluffy_Pillow 21160.3/63371: 33% mana arcane_charge(2), clearcasting, rune_of_power
2:07.257 aoe o arcane_explosion Fluffy_Pillow 22816.8/63371: 36% mana arcane_charge(3), rune_of_power
2:08.564 aoe p arcane_barrage Fluffy_Pillow 19473.3/63371: 31% mana arcane_charge(4), rune_of_power
2:09.869 aoe o arcane_explosion Fluffy_Pillow 23662.2/63371: 37% mana rune_of_power
2:11.177 aoe n shifting_power Fluffy_Pillow 20320.0/63371: 32% mana arcane_charge
2:14.879 aoe o arcane_explosion Fluffy_Pillow 22512.0/63371: 36% mana arcane_charge
2:16.186 aoe o arcane_explosion Fluffy_Pillow 19168.5/63371: 30% mana arcane_charge(2)
2:17.491 aoe o arcane_explosion Fluffy_Pillow 15822.5/63371: 25% mana arcane_charge(3)
2:18.800 aoe p arcane_barrage Fluffy_Pillow 12481.6/63371: 20% mana arcane_charge(4)
2:20.107 aoe m arcane_orb Fluffy_Pillow 16673.0/63371: 26% mana
2:21.413 aoe p arcane_barrage Fluffy_Pillow 17828.2/63371: 28% mana arcane_charge(4)
2:22.720 aoe o arcane_explosion Fluffy_Pillow 22019.6/63371: 35% mana
2:24.027 shared_cds r use_mana_gem NightFae_Koraylon 18676.2/63371: 29% mana arcane_charge, clearcasting
2:24.027 aoe o arcane_explosion Fluffy_Pillow 25013.3/63371: 39% mana arcane_charge, clearcasting
2:25.335 aoe o arcane_explosion Fluffy_Pillow 26671.1/63371: 42% mana arcane_charge(2)
2:26.639 aoe o arcane_explosion Fluffy_Pillow 23323.8/63371: 37% mana arcane_charge(3)
2:27.943 aoe p arcane_barrage Fluffy_Pillow 19976.5/63371: 32% mana arcane_charge(4)
2:29.249 aoe j touch_of_the_magi Fluffy_Pillow 24166.7/63371: 38% mana
2:30.556 aoe l rune_of_power Fluffy_Pillow 23323.2/63371: 37% mana arcane_charge(4)
2:31.862 aoe p arcane_barrage Fluffy_Pillow 24978.5/63371: 39% mana arcane_charge(4), rune_of_power
2:33.170 aoe o arcane_explosion Fluffy_Pillow 29171.1/63371: 46% mana rune_of_power
2:34.477 aoe o arcane_explosion Fluffy_Pillow 25827.6/63371: 41% mana arcane_charge, clearcasting, rune_of_power
2:35.783 aoe o arcane_explosion Fluffy_Pillow 27482.9/63371: 43% mana arcane_charge(2), rune_of_power
2:37.089 aoe o arcane_explosion Fluffy_Pillow 24138.2/63371: 38% mana arcane_charge(3), rune_of_power
2:38.395 aoe p arcane_barrage Fluffy_Pillow 20793.4/63371: 33% mana arcane_charge(4), rune_of_power
2:39.701 aoe o arcane_explosion Fluffy_Pillow 24983.5/63371: 39% mana rune_of_power
2:41.009 aoe o arcane_explosion Fluffy_Pillow 21641.3/63371: 34% mana arcane_charge, rune_of_power
2:42.316 aoe o arcane_explosion Fluffy_Pillow 18297.9/63371: 29% mana arcane_charge(2), clearcasting, rune_of_power
2:43.623 aoe o arcane_explosion Fluffy_Pillow 19954.4/63371: 31% mana arcane_charge(3), rune_of_power
2:44.930 aoe p arcane_barrage Fluffy_Pillow 16610.9/63371: 26% mana arcane_charge(4), rune_of_power
2:46.238 aoe m arcane_orb Fluffy_Pillow 20803.6/63371: 33% mana rune_of_power
2:47.545 aoe p arcane_barrage Fluffy_Pillow 21960.1/63371: 35% mana arcane_charge(4)
2:48.852 aoe o arcane_explosion Fluffy_Pillow 26151.5/63371: 41% mana
2:50.158 aoe o arcane_explosion Fluffy_Pillow 22806.8/63371: 36% mana arcane_charge, clearcasting
2:51.463 aoe o arcane_explosion Fluffy_Pillow 24460.8/63371: 39% mana arcane_charge(2)
2:52.772 aoe o arcane_explosion Fluffy_Pillow 21119.8/63371: 33% mana arcane_charge(3)
2:54.079 aoe p arcane_barrage Fluffy_Pillow 17776.3/63371: 28% mana arcane_charge(4)
2:55.386 aoe o arcane_explosion Fluffy_Pillow 21967.7/63371: 35% mana
2:56.693 aoe n shifting_power Fluffy_Pillow 18624.3/63371: 29% mana arcane_charge
3:00.419 aoe o arcane_explosion Fluffy_Pillow 20846.7/63371: 33% mana arcane_charge
3:01.726 aoe o arcane_explosion Fluffy_Pillow 17503.2/63371: 28% mana arcane_charge(2)
3:03.034 aoe o arcane_explosion Fluffy_Pillow 14161.0/63371: 22% mana arcane_charge(3)
3:04.340 aoe p arcane_barrage Fluffy_Pillow 10816.3/63371: 17% mana arcane_charge(4)
3:05.646 aoe m arcane_orb Fluffy_Pillow 15006.4/63371: 24% mana
3:06.953 aoe p arcane_barrage Fluffy_Pillow 16162.9/63371: 26% mana arcane_charge(4)
3:08.259 aoe o arcane_explosion Fluffy_Pillow 20353.1/63371: 32% mana
3:09.565 aoe o arcane_explosion Fluffy_Pillow 17008.3/63371: 27% mana arcane_charge
3:10.872 aoe o arcane_explosion Fluffy_Pillow 13664.8/63371: 22% mana arcane_charge(2), clearcasting
3:12.178 aoe o arcane_explosion Fluffy_Pillow 15320.1/63371: 24% mana arcane_charge(3)
3:13.485 aoe p arcane_barrage Fluffy_Pillow 11976.6/63371: 19% mana arcane_charge(4)
3:14.792 aoe j touch_of_the_magi Fluffy_Pillow 16168.0/63371: 26% mana
3:16.098 aoe k arcane_power Fluffy_Pillow 15323.3/63371: 24% mana arcane_charge(4)
3:16.098 shared_cds t berserking Fluffy_Pillow 15323.3/63371: 24% mana arcane_charge(4), arcane_power, rune_of_power
3:16.098 aoe p arcane_barrage Fluffy_Pillow 15323.3/63371: 24% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.287 aoe o arcane_explosion Fluffy_Pillow 19365.1/63371: 31% mana berserking, arcane_power, rune_of_power
3:18.475 aoe o arcane_explosion Fluffy_Pillow 18370.8/63371: 29% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.662 aoe o arcane_explosion Fluffy_Pillow 17375.3/63371: 27% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.850 aoe o arcane_explosion Fluffy_Pillow 16381.0/63371: 26% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:22.039 aoe p arcane_barrage Fluffy_Pillow 15387.9/63371: 24% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.226 aoe o arcane_explosion Fluffy_Pillow 19427.2/63371: 31% mana berserking, arcane_power, rune_of_power
3:24.414 aoe o arcane_explosion Fluffy_Pillow 18432.9/63371: 29% mana berserking, arcane_charge, arcane_power, rune_of_power
3:25.603 aoe o arcane_explosion Fluffy_Pillow 17439.9/63371: 28% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:26.791 aoe o arcane_explosion Fluffy_Pillow 16445.6/63371: 26% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:27.978 aoe p arcane_barrage Fluffy_Pillow 15450.1/63371: 24% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:29.167 aoe m arcane_orb Fluffy_Pillow 19491.9/63371: 31% mana arcane_power, rune_of_power
3:30.474 aoe p arcane_barrage Fluffy_Pillow 20898.4/63371: 33% mana arcane_charge(4), arcane_power, rune_of_power
3:31.877 aoe o arcane_explosion Fluffy_Pillow 25211.5/63371: 40% mana
3:33.183 aoe o arcane_explosion Fluffy_Pillow 21866.7/63371: 35% mana arcane_charge
3:34.490 aoe o arcane_explosion Fluffy_Pillow 18523.3/63371: 29% mana arcane_charge(2), clearcasting
3:35.798 aoe o arcane_explosion Fluffy_Pillow 20181.1/63371: 32% mana arcane_charge(3)
3:37.103 aoe l rune_of_power Fluffy_Pillow 16835.1/63371: 27% mana arcane_charge(4)
3:38.410 aoe p arcane_barrage Fluffy_Pillow 18491.6/63371: 29% mana arcane_charge(4), rune_of_power
3:39.717 aoe o arcane_explosion Fluffy_Pillow 22683.0/63371: 36% mana rune_of_power
3:41.023 aoe o arcane_explosion Fluffy_Pillow 19338.2/63371: 31% mana arcane_charge, rune_of_power
3:42.330 aoe o arcane_explosion Fluffy_Pillow 15994.8/63371: 25% mana arcane_charge(2), rune_of_power
3:43.635 aoe o arcane_explosion Fluffy_Pillow 12648.8/63371: 20% mana arcane_charge(3), rune_of_power
3:44.941 aoe p arcane_barrage Fluffy_Pillow 9304.0/63371: 15% mana arcane_charge(4), rune_of_power
3:46.249 aoe o arcane_explosion Fluffy_Pillow 13496.7/63371: 21% mana rune_of_power
3:47.556 aoe o arcane_explosion Fluffy_Pillow 10153.2/63371: 16% mana arcane_charge, clearcasting, rune_of_power
3:48.861 aoe o arcane_explosion Fluffy_Pillow 11807.2/63371: 19% mana arcane_charge(2), rune_of_power
3:50.169 aoe o arcane_explosion Fluffy_Pillow 8465.0/63371: 13% mana arcane_charge(3), rune_of_power
3:51.475 aoe p arcane_barrage Fluffy_Pillow 5120.3/63371: 8% mana arcane_charge(4), rune_of_power
3:52.782 aoe m arcane_orb Fluffy_Pillow 9311.6/63371: 15% mana rune_of_power
3:54.090 aoe n shifting_power Fluffy_Pillow 10469.4/63371: 17% mana arcane_charge(4)
3:57.834 aoe p arcane_barrage Fluffy_Pillow 12714.7/63371: 20% mana arcane_charge(4)
3:59.139 aoe o arcane_explosion Fluffy_Pillow 16903.5/63371: 27% mana
4:00.444 aoe o arcane_explosion Fluffy_Pillow 13557.5/63371: 21% mana arcane_charge, clearcasting
4:01.751 aoe o arcane_explosion Fluffy_Pillow 15214.1/63371: 24% mana arcane_charge(2)
4:03.059 aoe o arcane_explosion Fluffy_Pillow 11871.9/63371: 19% mana arcane_charge(3)
4:04.365 aoe p arcane_barrage Fluffy_Pillow 8527.1/63371: 13% mana arcane_charge(4)
4:05.674 aoe m arcane_orb Fluffy_Pillow 12721.0/63371: 20% mana
4:06.980 aoe p arcane_barrage Fluffy_Pillow 13876.3/63371: 22% mana arcane_charge(4)
4:08.285 aoe o arcane_explosion Fluffy_Pillow 18065.2/63371: 29% mana
4:09.592 aoe o arcane_explosion Fluffy_Pillow 14721.7/63371: 23% mana arcane_charge, clearcasting
4:10.900 aoe j touch_of_the_magi Fluffy_Pillow 16379.5/63371: 26% mana arcane_charge(2)
4:12.207 aoe l rune_of_power Fluffy_Pillow 15536.0/63371: 25% mana arcane_charge(4)
4:13.514 aoe p arcane_barrage Fluffy_Pillow 17192.5/63371: 27% mana arcane_charge(4), rune_of_power
4:14.821 aoe o arcane_explosion Fluffy_Pillow 21383.9/63371: 34% mana rune_of_power
4:16.129 aoe o arcane_explosion Fluffy_Pillow 18041.7/63371: 28% mana arcane_charge, rune_of_power
4:17.435 aoe o arcane_explosion Fluffy_Pillow 14697.0/63371: 23% mana arcane_charge(2), rune_of_power
4:18.741 aoe o arcane_explosion Fluffy_Pillow 11352.2/63371: 18% mana arcane_charge(3), clearcasting, rune_of_power
4:20.046 aoe p arcane_barrage Fluffy_Pillow 13006.2/63371: 21% mana arcane_charge(4), rune_of_power
4:21.351 aoe o arcane_explosion Fluffy_Pillow 17195.1/63371: 27% mana rune_of_power
4:22.657 aoe o arcane_explosion Fluffy_Pillow 13850.4/63371: 22% mana arcane_charge, rune_of_power
4:23.964 shared_cds r use_mana_gem NightFae_Koraylon 10506.9/63371: 17% mana arcane_charge(2), rune_of_power
4:24.027 aoe o arcane_explosion Fluffy_Pillow 16923.9/63371: 27% mana arcane_charge(2), rune_of_power
4:25.335 aoe o arcane_explosion Fluffy_Pillow 13581.7/63371: 21% mana arcane_charge(3), clearcasting, rune_of_power
4:26.641 aoe p arcane_barrage Fluffy_Pillow 15236.9/63371: 24% mana arcane_charge(4), rune_of_power
4:27.949 aoe m arcane_orb Fluffy_Pillow 19429.6/63371: 31% mana rune_of_power
4:29.256 aoe p arcane_barrage Fluffy_Pillow 20586.1/63371: 32% mana arcane_charge(4)
4:30.562 aoe o arcane_explosion Fluffy_Pillow 24776.2/63371: 39% mana
4:31.868 aoe o arcane_explosion Fluffy_Pillow 21431.5/63371: 34% mana arcane_charge
4:33.174 aoe o arcane_explosion Fluffy_Pillow 18086.8/63371: 29% mana arcane_charge(2)
4:34.479 aoe o arcane_explosion Fluffy_Pillow 14740.7/63371: 23% mana arcane_charge(3)
4:35.787 aoe p arcane_barrage Fluffy_Pillow 11398.5/63371: 18% mana arcane_charge(4)
4:37.092 aoe o arcane_explosion Fluffy_Pillow 15587.4/63371: 25% mana
4:38.397 aoe o arcane_explosion Fluffy_Pillow 12241.4/63371: 19% mana arcane_charge
4:39.701 aoe n shifting_power Fluffy_Pillow 8894.1/63371: 14% mana arcane_charge(2)
4:43.450 aoe o arcane_explosion Fluffy_Pillow 11145.7/63371: 18% mana arcane_charge(2)
4:44.756 aoe o arcane_explosion Fluffy_Pillow 7801.0/63371: 12% mana arcane_charge(3)
4:46.062 aoe p arcane_barrage Fluffy_Pillow 4456.2/63371: 7% mana arcane_charge(4)
4:47.369 aoe m arcane_orb Fluffy_Pillow 8647.6/63371: 14% mana
4:48.677 aoe p arcane_barrage Fluffy_Pillow 9805.4/63371: 15% mana arcane_charge(4)
4:49.984 aoe o arcane_explosion Fluffy_Pillow 13996.8/63371: 22% mana
4:51.289 aoe j touch_of_the_magi Fluffy_Pillow 10650.8/63371: 17% mana arcane_charge
4:52.594 aoe k arcane_power Fluffy_Pillow 9804.8/63371: 15% mana arcane_charge(4)
4:52.594 aoe p arcane_barrage Fluffy_Pillow 9804.8/63371: 15% mana arcane_charge(4), arcane_power, rune_of_power
4:53.901 aoe o arcane_explosion Fluffy_Pillow 13996.2/63371: 22% mana arcane_power, rune_of_power
4:55.208 aoe o arcane_explosion Fluffy_Pillow 13152.7/63371: 21% mana arcane_charge, arcane_power, rune_of_power
4:56.515 aoe o arcane_explosion Fluffy_Pillow 12309.2/63371: 19% mana arcane_charge(2), arcane_power, rune_of_power
4:57.821 aoe o arcane_explosion Fluffy_Pillow 11464.5/63371: 18% mana arcane_charge(3), arcane_power, rune_of_power
4:59.127 aoe p arcane_barrage Fluffy_Pillow 10619.8/63371: 17% mana arcane_charge(4), arcane_power, rune_of_power
5:00.432 aoe o arcane_explosion Fluffy_Pillow 14808.6/63371: 23% mana arcane_power, rune_of_power
5:01.739 shared_cds s potion Fluffy_Pillow 13965.1/63371: 22% mana arcane_charge, arcane_power, rune_of_power
5:01.739 aoe o arcane_explosion Fluffy_Pillow 13965.1/63371: 22% mana arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
5:03.044 aoe o arcane_explosion Fluffy_Pillow 13119.1/63371: 21% mana arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
5:04.350 aoe o arcane_explosion Fluffy_Pillow 12274.4/63371: 19% mana arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
5:05.658 aoe p arcane_barrage Fluffy_Pillow 11432.2/63371: 18% mana arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
5:06.965 aoe o arcane_explosion Fluffy_Pillow 15623.6/63371: 25% mana arcane_power, rune_of_power, potion_of_deathly_fixation
5:08.270 aoe o arcane_explosion Fluffy_Pillow 14777.6/63371: 23% mana arcane_charge, potion_of_deathly_fixation
5:09.576 aoe o arcane_explosion Fluffy_Pillow 11432.8/63371: 18% mana arcane_charge(2), clearcasting, potion_of_deathly_fixation
5:10.884 aoe o arcane_explosion Fluffy_Pillow 13090.6/63371: 21% mana arcane_charge(3), potion_of_deathly_fixation
5:12.190 aoe l rune_of_power Fluffy_Pillow 9745.9/63371: 15% mana arcane_charge(4), potion_of_deathly_fixation
5:13.498 aoe p arcane_barrage Fluffy_Pillow 11403.7/63371: 18% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:14.804 aoe m arcane_orb Fluffy_Pillow 15593.8/63371: 25% mana rune_of_power, potion_of_deathly_fixation
5:16.111 aoe p arcane_barrage Fluffy_Pillow 16750.3/63371: 26% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:17.418 aoe o arcane_explosion Fluffy_Pillow 20941.7/63371: 33% mana rune_of_power, potion_of_deathly_fixation
5:18.722 aoe o arcane_explosion Fluffy_Pillow 17594.4/63371: 28% mana arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
5:20.030 aoe o arcane_explosion Fluffy_Pillow 19252.2/63371: 30% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:21.337 aoe o arcane_explosion Fluffy_Pillow 15908.8/63371: 25% mana arcane_charge(3), clearcasting, rune_of_power, potion_of_deathly_fixation
5:22.646 aoe p arcane_barrage Fluffy_Pillow 17567.8/63371: 28% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:23.951 aoe o arcane_explosion Fluffy_Pillow 21756.7/63371: 34% mana rune_of_power, potion_of_deathly_fixation
5:25.257 aoe o arcane_explosion Fluffy_Pillow 18412.0/63371: 29% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:26.563 aoe o arcane_explosion Fluffy_Pillow 15067.2/63371: 24% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:27.869 aoe o arcane_explosion Fluffy_Pillow 11722.5/63371: 18% mana arcane_charge(3), clearcasting, rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Koraylon"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=325066//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Niya : 11432 dps, 4830 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11432.1 11432.1 15.1 / 0.132% 999.5 / 8.7% 6.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
1892.8 1809.8 Mana 0.00% 48.0 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 11432
Arcane Barrage 4113 36.0% 54.5 5.54sec 22664 18304 Direct 163.2 6336 12675 7566 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.48 163.25 0.00 0.00 1.2382 0.0000 1234830.61 1234830.61 0.00% 18304.36 18304.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 131.55 98 170 6335.87 2082 26188 6338.39 5663 7084 833031 833031 0.00%
crit 19.42% 31.70 16 53 12675.09 4164 52026 12682.12 8175 18286 401800 401800 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.49
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 289 2.5% 41.5 6.89sec 2098 0 Direct 124.4 586 1171 700 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.47 124.42 0.00 0.00 0.0000 0.0000 87026.57 87026.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 100.29 69 131 586.17 443 664 586.13 562 610 58780 58780 0.00%
crit 19.39% 24.13 10 43 1170.62 886 1329 1170.57 984 1292 28247 28247 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4775 41.8% 143.3 2.07sec 10016 8052 Direct 429.9 2798 5595 3339 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 143.29 429.86 0.00 0.00 1.2439 0.0000 1435182.90 1435182.90 0.00% 8052.28 8052.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 346.80 269 423 2798.25 1958 4400 2797.87 2695 2882 970504 970504 0.00%
crit 19.32% 83.07 44 120 5594.93 3916 8800 5590.38 4865 6202 464678 464678 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:143.27
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (902) 0.0% (7.9%) 14.0 22.19sec 19398 15703

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.95 0.00 0.00 0.00 1.2353 0.0000 0.00 0.00 0.00% 15702.75 15702.75

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.95
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 902 7.9% 41.8 22.19sec 6475 0 Direct 41.8 5439 10863 6475 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.79 41.79 0.00 0.00 0.0000 0.0000 270621.26 270621.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.90% 33.81 22 45 5439.27 3869 8553 5450.50 4970 5969 183961 183961 0.00%
crit 19.10% 7.98 0 19 10863.42 7739 17011 10863.42 0 16315 86660 86660 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (0.8%) 18.9 8.88sec 1385 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 0.8% 18.9 8.88sec 1385 0 Direct 18.9 1164 2327 1385 19.0%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.88 18.88 0.00 0.00 0.0000 0.0000 26147.74 26147.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.96% 15.28 5 29 1163.53 1164 1164 1163.53 1164 1164 17784 17784 0.00%
crit 19.04% 3.59 0 11 2327.06 2327 2327 2275.07 0 2327 8364 8364 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1761 18.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1759.88 1759.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.14% 0.81 0 1 1480.68 1481 1481 1201.48 0 1481 1201 1201 0.00%
crit 18.86% 0.19 0 1 2961.35 2961 2961 558.40 0 2961 558 558 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6043 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6042.60 6042.60 0.00% 51.30 51.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 72.50 57 83 56.25 43 60 56.25 55 58 4078 4078 0.00%
crit 19.44% 17.50 7 33 112.28 86 120 112.24 99 120 1965 1965 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 386 3.4% 6.0 49.52sec 19493 5467 Periodic 70.9 1372 2745 1636 19.2% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 0.00 23.64 70.93 3.5655 0.8342 116015.68 116015.68 0.00% 5467.28 5467.28
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 57.31 37 76 1372.31 1372 1372 1372.31 1372 1372 78653 78653 0.00%
crit 19.19% 13.61 4 27 2744.61 2745 2745 2744.61 2745 2745 37363 37363 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.95
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (856) 0.0% (7.5%) 6.6 49.12sec 39037 29881

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.58 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 29881.44 29881.44

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.63
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 856 7.5% 6.6 49.01sec 39037 0 Direct 19.7 13093 0 13093 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.58 19.65 0.00 0.00 0.0000 0.0000 257040.12 257040.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.65 15 24 13093.43 3446 50443 13104.73 10906 16416 257040 257040 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:35349.02
  • base_dd_max:35349.02
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Niya
Arcane Power 3.6 97.17sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.58
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.72sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.1 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.07 0.00 0.43 0.00 4.3335 0.7230 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.07
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.44sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 48.00sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.38 0.00 0.00 0.00 1.2595 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.41
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.56sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.81
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.2 150.4 5.5sec 1.5sec 4.2sec 76.27% 0.00% 3.5 (5.5) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 9.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.6s

Stack Uptimes

  • arcane_charge_1:21.31%
  • arcane_charge_2:18.99%
  • arcane_charge_3:14.26%
  • arcane_charge_4:21.70%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.0s
  • trigger_min/max:96.0s / 102.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.09% 23.63% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:193.4s / 199.2s
  • trigger_min/max:193.4s / 199.2s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.09%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 0.2 12.9sec 12.8sec 2.2sec 16.30% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.08%
  • clearcasting_2:0.22%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.1 0.0 0.0sec 0.0sec 4.3sec 0.10% 0.00% 0.3 (0.3) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:3.6s / 4.3s

Stack Uptimes

  • evocation_1:0.12%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.4sec 300.4sec 23.3sec 11.32% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.1s
  • trigger_min/max:300.0s / 301.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.32%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Redirected Anima 16.7 0.0 52.1sec 17.0sec 65.5sec 83.73% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.5s / 323.5s
  • trigger_min/max:0.3s / 57.8s
  • trigger_pct:98.53%
  • duration_min/max:0.0s / 343.5s

Stack Uptimes

  • redirected_anima_1:17.09%
  • redirected_anima_2:7.74%
  • redirected_anima_3:2.36%
  • redirected_anima_4:0.58%
  • redirected_anima_5:0.09%
  • redirected_anima_6:16.51%
  • redirected_anima_7:23.33%
  • redirected_anima_8:11.40%
  • redirected_anima_9:3.62%
  • redirected_anima_10:0.82%
  • redirected_anima_11:0.20%
  • redirected_anima_12:0.09%
  • redirected_anima_13:0.04%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.5sec 31.5sec 14.6sec 48.45% 0.00% 0.0 (0.0) 9.5

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.6s
  • trigger_min/max:16.8s / 48.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.45%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.59% 0.76% 5.42% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.737144.053263.903
Evocation230.427137.305327.810296.905187.603359.846
Rune of Power14.2700.33136.51094.16578.879109.847
Touch of the Magi10.8580.00018.10473.79457.20392.664
Arcane Power1.2060.0045.9884.3262.7738.660
Arcane Barrage3.0250.00012.258166.210132.230202.592
Arcane Orb4.5700.00012.44964.32944.67283.040
Shifting Power9.3430.00033.25255.69950.67762.153

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
mana_regen Mana 709.67 384768.22 70.69% 542.18 7183.33 1.83%
Evocation Mana 3.39 3467.38 0.64% 1023.00 0.00 0.00%
Mana Gem Mana 2.81 18366.59 3.37% 6530.73 0.00 0.00%
Arcane Barrage Mana 54.49 137677.82 25.30% 2526.59 4382.93 3.09%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1809.84 1892.81 11573.4 37343.5 1898.9 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Niya
arcane_explosion Mana 143.3 530594.7 3703.5 3703.0 2.7
arcane_orb Mana 14.0 6224.0 446.1 446.1 43.5
shifting_power Mana 6.0 14881.1 2500.0 2500.3 7.8
touch_of_the_magi Mana 6.6 16475.8 2500.0 2502.2 15.6

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Niya Damage Per Second
Count 1119
Mean 11432.12
Minimum 10664.87
Maximum 12297.64
Spread ( max - min ) 1632.77
Range [ ( max - min ) / 2 * 100% ] 7.14%
Standard Deviation 258.4295
5th Percentile 11017.94
95th Percentile 11861.77
( 95th Percentile - 5th Percentile ) 843.83
Mean Distribution
Standard Deviation 7.7255
95.00% Confidence Interval ( 11416.98 - 11447.26 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1964
0.1 Scale Factor Error with Delta=300 571
0.05 Scale Factor Error with Delta=300 2281
0.01 Scale Factor Error with Delta=300 57013
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 1119
Mean 4830.49
Minimum 4336.32
Maximum 5446.12
Spread ( max - min ) 1109.80
Range [ ( max - min ) / 2 * 100% ] 11.49%
Standard Deviation 168.3876
5th Percentile 4567.72
95th Percentile 5103.05
( 95th Percentile - 5th Percentile ) 535.33
Mean Distribution
Standard Deviation 5.0338
95.00% Confidence Interval ( 4820.63 - 4840.36 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4669
0.1 Scale Factor Error with Delta=300 243
0.05 Scale Factor Error with Delta=300 969
0.01 Scale Factor Error with Delta=300 24205
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 1119
Mean 11432.12
Minimum 10664.87
Maximum 12297.64
Spread ( max - min ) 1632.77
Range [ ( max - min ) / 2 * 100% ] 7.14%
Damage
NightFae_Niya Damage
Count 1119
Mean 3428624.75
Minimum 2721854.49
Maximum 4149384.06
Spread ( max - min ) 1427529.58
Range [ ( max - min ) / 2 * 100% ] 20.82%
DTPS
NightFae_Niya Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.63 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.58 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.41 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.95 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.95 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 143.27 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.49 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.07 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.81 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmporooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpoooopooroopmpoooopoonoopmpojkpooooposooopoooolpmpoooopoooo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Niya 63371.4/63371: 100% mana
Pre precombat R food NightFae_Niya 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.308 aoe k arcane_power Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4)
0:01.308 shared_cds s potion Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.308 shared_cds t berserking Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.308 aoe p arcane_barrage Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.223 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.137 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.051 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.965 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:05.881 aoe o arcane_explosion Fluffy_Pillow 63190.8/63371: 100% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.796 aoe o arcane_explosion Fluffy_Pillow 61850.5/63371: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:07.711 aoe p arcane_barrage Fluffy_Pillow 63010.2/63371: 99% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.626 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.541 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.454 aoe o arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.369 aoe o arcane_explosion Fluffy_Pillow 59348.0/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.281 aoe p arcane_barrage Fluffy_Pillow 58003.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.196 aoe o arcane_explosion Fluffy_Pillow 61698.4/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.112 aoe o arcane_explosion Fluffy_Pillow 60359.4/63371: 95% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.120 aoe o arcane_explosion Fluffy_Pillow 59137.0/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.127 aoe o arcane_explosion Fluffy_Pillow 57913.3/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:17.133 aoe l rune_of_power Fluffy_Pillow 59188.3/63371: 93% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.139 aoe p arcane_barrage Fluffy_Pillow 60463.3/63371: 95% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.145 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.153 aoe o arcane_explosion Fluffy_Pillow 59649.0/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
0:21.160 aoe o arcane_explosion Fluffy_Pillow 60925.3/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.166 aoe o arcane_explosion Fluffy_Pillow 57200.3/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.172 shared_cds r use_mana_gem NightFae_Niya 53475.4/63371: 84% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:23.172 aoe p arcane_barrage Fluffy_Pillow 59812.5/63371: 94% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:24.178 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:25.184 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:26.188 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.194 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power
0:28.201 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power
0:29.207 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power
0:30.213 aoe p arcane_barrage Fluffy_Pillow 52197.8/63371: 82% mana bloodlust, arcane_charge(4), rune_of_power
0:31.218 aoe o arcane_explosion Fluffy_Pillow 56006.4/63371: 88% mana bloodlust, rune_of_power
0:32.224 aoe o arcane_explosion Fluffy_Pillow 52281.5/63371: 83% mana bloodlust, arcane_charge, rune_of_power
0:33.230 aoe n shifting_power Fluffy_Pillow 48556.5/63371: 77% mana bloodlust, arcane_charge(2)
0:36.177 aoe o arcane_explosion Fluffy_Pillow 51812.0/65943: 79% mana bloodlust, arcane_charge(2), redirected_anima(6)
0:37.184 aoe o arcane_explosion Fluffy_Pillow 48140.1/65943: 73% mana bloodlust, arcane_charge(3), redirected_anima(6)
0:38.190 aoe p arcane_barrage Fluffy_Pillow 44466.9/65943: 67% mana bloodlust, arcane_charge(4), redirected_anima(6)
0:39.196 aoe m arcane_orb Fluffy_Pillow 48746.1/66371: 73% mana bloodlust, redirected_anima(7)
0:40.202 aoe p arcane_barrage Fluffy_Pillow 49581.5/66371: 75% mana bloodlust, arcane_charge(4), redirected_anima(7)
0:41.208 aoe o arcane_explosion Fluffy_Pillow 53571.7/66371: 81% mana redirected_anima(7)
0:42.514 aoe o arcane_explosion Fluffy_Pillow 50305.4/66371: 76% mana arcane_charge, redirected_anima(7)
0:43.820 aoe o arcane_explosion Fluffy_Pillow 47039.0/66371: 71% mana arcane_charge(2), clearcasting, redirected_anima(7)
0:45.126 aoe o arcane_explosion Fluffy_Pillow 48772.6/66371: 73% mana arcane_charge(3), redirected_anima(7)
0:46.430 aoe p arcane_barrage Fluffy_Pillow 45503.6/66371: 69% mana arcane_charge(4), redirected_anima(7)
0:47.736 aoe o arcane_explosion Fluffy_Pillow 49892.1/66371: 75% mana redirected_anima(7)
0:49.044 aoe o arcane_explosion Fluffy_Pillow 46929.4/66800: 70% mana arcane_charge, clearcasting, redirected_anima(8)
0:50.351 aoe j touch_of_the_magi Fluffy_Pillow 48675.6/66800: 73% mana arcane_charge(2), redirected_anima(8)
0:51.656 aoe l rune_of_power Fluffy_Pillow 47919.1/66800: 72% mana arcane_charge(4), redirected_anima(8)
0:52.963 aoe p arcane_barrage Fluffy_Pillow 49665.2/66800: 74% mana arcane_charge(4), rune_of_power, redirected_anima(8)
0:54.270 aoe o arcane_explosion Fluffy_Pillow 54083.4/66800: 81% mana rune_of_power, redirected_anima(8)
0:55.577 aoe o arcane_explosion Fluffy_Pillow 50829.5/66800: 76% mana arcane_charge, rune_of_power, redirected_anima(8)
0:56.884 aoe o arcane_explosion Fluffy_Pillow 47575.7/66800: 71% mana arcane_charge(2), rune_of_power, redirected_anima(8)
0:58.190 aoe o arcane_explosion Fluffy_Pillow 44320.5/66800: 66% mana arcane_charge(3), clearcasting, rune_of_power, redirected_anima(8)
0:59.497 aoe p arcane_barrage Fluffy_Pillow 46066.6/66800: 69% mana arcane_charge(4), rune_of_power, redirected_anima(8)
1:00.802 aoe m arcane_orb Fluffy_Pillow 50482.1/66800: 76% mana rune_of_power, redirected_anima(8)
1:02.108 aoe p arcane_barrage Fluffy_Pillow 51726.9/66800: 77% mana arcane_charge(4), rune_of_power, redirected_anima(8)
1:03.414 aoe o arcane_explosion Fluffy_Pillow 53982.5/64229: 84% mana rune_of_power, redirected_anima(2)
1:04.721 aoe o arcane_explosion Fluffy_Pillow 50661.5/64229: 79% mana arcane_charge, rune_of_power, redirected_anima(2)
1:06.027 aoe o arcane_explosion Fluffy_Pillow 47339.1/64229: 74% mana arcane_charge(2), rune_of_power, redirected_anima(2)
1:07.333 aoe o arcane_explosion Fluffy_Pillow 44016.8/64229: 69% mana arcane_charge(3), clearcasting, rune_of_power, redirected_anima(2)
1:08.640 aoe p arcane_barrage Fluffy_Pillow 45695.7/64229: 71% mana arcane_charge(4), redirected_anima(2)
1:09.947 aoe o arcane_explosion Fluffy_Pillow 49943.8/64229: 78% mana redirected_anima(2)
1:11.254 aoe o arcane_explosion Fluffy_Pillow 46622.7/64229: 73% mana arcane_charge, redirected_anima(2)
1:12.561 aoe o arcane_explosion Fluffy_Pillow 43301.6/64229: 67% mana arcane_charge(2), clearcasting, redirected_anima(2)
1:13.869 aoe o arcane_explosion Fluffy_Pillow 44981.9/64229: 70% mana arcane_charge(3), redirected_anima(2)
1:15.177 aoe p arcane_barrage Fluffy_Pillow 41662.1/64229: 65% mana arcane_charge(4), clearcasting, redirected_anima(2)
1:16.485 aoe o arcane_explosion Fluffy_Pillow 45911.4/64229: 71% mana clearcasting, redirected_anima(2)
1:17.790 aoe o arcane_explosion Fluffy_Pillow 47270.3/63800: 74% mana arcane_charge, redirected_anima
1:19.095 aoe n shifting_power Fluffy_Pillow 43935.4/63800: 69% mana arcane_charge(2), redirected_anima
1:22.904 aoe o arcane_explosion Fluffy_Pillow 48472.6/66800: 73% mana arcane_charge(2), redirected_anima(8)
1:24.212 aoe o arcane_explosion Fluffy_Pillow 45220.1/66800: 68% mana arcane_charge(3), redirected_anima(8)
1:25.518 aoe p arcane_barrage Fluffy_Pillow 41965.0/66800: 63% mana arcane_charge(4), redirected_anima(8)
1:26.826 aoe m arcane_orb Fluffy_Pillow 46384.4/66800: 69% mana redirected_anima(8)
1:28.131 aoe p arcane_barrage Fluffy_Pillow 47627.9/66800: 71% mana arcane_charge(4), redirected_anima(8)
1:29.437 aoe o arcane_explosion Fluffy_Pillow 52044.7/66800: 78% mana redirected_anima(8)
1:30.744 aoe o arcane_explosion Fluffy_Pillow 48790.9/66800: 73% mana arcane_charge, redirected_anima(8)
1:32.050 aoe o arcane_explosion Fluffy_Pillow 45535.7/66800: 68% mana arcane_charge(2), redirected_anima(8)
1:33.356 aoe o arcane_explosion Fluffy_Pillow 42551.8/67229: 63% mana arcane_charge(3), redirected_anima(9)
1:34.663 aoe p arcane_barrage Fluffy_Pillow 39309.1/67229: 58% mana arcane_charge(4), redirected_anima(9)
1:35.971 aoe o arcane_explosion Fluffy_Pillow 43757.0/67229: 65% mana redirected_anima(9)
1:37.276 aoe j touch_of_the_magi Fluffy_Pillow 40511.6/67229: 60% mana arcane_charge, clearcasting, redirected_anima(9)
1:38.582 aoe k arcane_power Fluffy_Pillow 39498.2/66800: 59% mana arcane_charge(4), clearcasting, redirected_anima(8)
1:38.582 aoe p arcane_barrage Fluffy_Pillow 39498.2/66800: 59% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima(8)
1:39.889 aoe o arcane_explosion Fluffy_Pillow 43916.4/66800: 66% mana arcane_power, clearcasting, rune_of_power, redirected_anima(8)
1:41.195 aoe o arcane_explosion Fluffy_Pillow 45661.2/66800: 68% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(8)
1:42.500 aoe o arcane_explosion Fluffy_Pillow 44904.7/66800: 67% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(8)
1:43.806 aoe o arcane_explosion Fluffy_Pillow 44149.5/66800: 66% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(8)
1:45.113 aoe p arcane_barrage Fluffy_Pillow 43395.6/66800: 65% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(8)
1:46.419 aoe o arcane_explosion Fluffy_Pillow 47812.4/66800: 72% mana arcane_power, rune_of_power, redirected_anima(8)
1:47.726 aoe o arcane_explosion Fluffy_Pillow 47058.6/66800: 70% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(8)
1:49.033 aoe o arcane_explosion Fluffy_Pillow 46304.7/66800: 69% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(8)
1:50.340 aoe o arcane_explosion Fluffy_Pillow 43505.2/63800: 68% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima
1:51.646 aoe p arcane_barrage Fluffy_Pillow 42671.6/63800: 67% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima
1:52.953 aoe m arcane_orb Fluffy_Pillow 46891.4/63800: 73% mana arcane_power, rune_of_power, redirected_anima
1:54.259 aoe l rune_of_power Fluffy_Pillow 48307.8/63800: 76% mana arcane_charge(4), redirected_anima
1:55.567 aoe p arcane_barrage Fluffy_Pillow 49976.8/63800: 78% mana arcane_charge(4), rune_of_power, redirected_anima
1:56.874 aoe o arcane_explosion Fluffy_Pillow 54196.6/63800: 85% mana rune_of_power, redirected_anima
1:58.181 aoe o arcane_explosion Fluffy_Pillow 50864.3/63800: 80% mana arcane_charge, rune_of_power, redirected_anima
1:59.488 aoe o arcane_explosion Fluffy_Pillow 47532.0/63800: 75% mana arcane_charge(2), rune_of_power, redirected_anima
2:00.795 aoe o arcane_explosion Fluffy_Pillow 44199.8/63800: 69% mana arcane_charge(3), rune_of_power, redirected_anima
2:02.102 aoe p arcane_barrage Fluffy_Pillow 40593.0/63371: 64% mana arcane_charge(4), rune_of_power
2:03.409 aoe o arcane_explosion Fluffy_Pillow 44784.4/63371: 71% mana rune_of_power
2:04.715 aoe o arcane_explosion Fluffy_Pillow 41439.6/63371: 65% mana arcane_charge, rune_of_power
2:06.021 aoe o arcane_explosion Fluffy_Pillow 38094.9/63371: 60% mana arcane_charge(2), rune_of_power
2:07.327 aoe o arcane_explosion Fluffy_Pillow 34750.2/63371: 55% mana arcane_charge(3), rune_of_power
2:08.633 aoe p arcane_barrage Fluffy_Pillow 31405.4/63371: 50% mana arcane_charge(4), rune_of_power
2:09.941 aoe o arcane_explosion Fluffy_Pillow 35598.1/63371: 56% mana rune_of_power
2:11.249 aoe n shifting_power Fluffy_Pillow 32255.9/63371: 51% mana arcane_charge, clearcasting
2:14.945 aoe o arcane_explosion Fluffy_Pillow 35837.8/65943: 54% mana arcane_charge, clearcasting(2), redirected_anima(6)
2:16.251 aoe o arcane_explosion Fluffy_Pillow 37560.2/65943: 57% mana arcane_charge(2), clearcasting, redirected_anima(6)
2:17.558 aoe o arcane_explosion Fluffy_Pillow 39283.9/65943: 60% mana arcane_charge(3), redirected_anima(6)
2:18.865 aoe p arcane_barrage Fluffy_Pillow 36007.7/65943: 55% mana arcane_charge(4), redirected_anima(6)
2:20.170 aoe m arcane_orb Fluffy_Pillow 40366.5/65943: 61% mana redirected_anima(6)
2:21.477 aoe p arcane_barrage Fluffy_Pillow 41590.3/65943: 63% mana arcane_charge(4), redirected_anima(6)
2:22.784 aoe o arcane_explosion Fluffy_Pillow 45951.7/65943: 70% mana redirected_anima(6)
2:24.090 shared_cds r use_mana_gem NightFae_Niya 42951.5/66371: 65% mana arcane_charge, redirected_anima(7)
2:24.090 aoe o arcane_explosion Fluffy_Pillow 49588.6/66371: 75% mana arcane_charge, redirected_anima(7)
2:25.397 aoe o arcane_explosion Fluffy_Pillow 46323.6/66371: 70% mana arcane_charge(2), redirected_anima(7)
2:26.704 aoe o arcane_explosion Fluffy_Pillow 43058.5/66371: 65% mana arcane_charge(3), clearcasting, redirected_anima(7)
2:28.011 aoe p arcane_barrage Fluffy_Pillow 44793.5/66371: 67% mana arcane_charge(4), redirected_anima(7)
2:29.317 aoe j touch_of_the_magi Fluffy_Pillow 49182.0/66371: 74% mana redirected_anima(7)
2:30.623 aoe l rune_of_power Fluffy_Pillow 48415.6/66371: 73% mana arcane_charge(4), redirected_anima(7)
2:31.929 aoe p arcane_barrage Fluffy_Pillow 50149.2/66371: 76% mana arcane_charge(4), rune_of_power, redirected_anima(7)
2:33.237 aoe o arcane_explosion Fluffy_Pillow 54540.3/66371: 82% mana rune_of_power, redirected_anima(7)
2:34.542 aoe o arcane_explosion Fluffy_Pillow 51272.6/66371: 77% mana arcane_charge, rune_of_power, redirected_anima(7)
2:35.848 aoe o arcane_explosion Fluffy_Pillow 48006.3/66371: 72% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(7)
2:37.155 aoe o arcane_explosion Fluffy_Pillow 49741.2/66371: 75% mana arcane_charge(3), rune_of_power, redirected_anima(7)
2:38.462 aoe p arcane_barrage Fluffy_Pillow 46476.1/66371: 70% mana arcane_charge(4), rune_of_power, redirected_anima(7)
2:39.768 aoe o arcane_explosion Fluffy_Pillow 50864.6/66371: 77% mana rune_of_power, redirected_anima(7)
2:41.074 aoe o arcane_explosion Fluffy_Pillow 47598.2/66371: 72% mana arcane_charge, rune_of_power, redirected_anima(7)
2:42.379 aoe o arcane_explosion Fluffy_Pillow 42613.0/63800: 67% mana arcane_charge(2), rune_of_power, redirected_anima
2:43.684 aoe o arcane_explosion Fluffy_Pillow 39278.2/63800: 62% mana arcane_charge(3), rune_of_power, redirected_anima
2:44.992 aoe p arcane_barrage Fluffy_Pillow 35947.2/63800: 56% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima
2:46.299 aoe m arcane_orb Fluffy_Pillow 40167.0/63800: 63% mana clearcasting, rune_of_power, redirected_anima
2:47.607 aoe p arcane_barrage Fluffy_Pillow 41336.0/63800: 65% mana arcane_charge(4), clearcasting, redirected_anima
2:48.911 aoe o arcane_explosion Fluffy_Pillow 45551.9/63800: 71% mana clearcasting, redirected_anima
2:50.218 aoe o arcane_explosion Fluffy_Pillow 47219.6/63800: 74% mana arcane_charge, redirected_anima
2:51.524 aoe o arcane_explosion Fluffy_Pillow 43886.1/63800: 69% mana arcane_charge(2), redirected_anima
2:52.830 aoe o arcane_explosion Fluffy_Pillow 40280.1/63371: 64% mana arcane_charge(3)
2:54.136 aoe p arcane_barrage Fluffy_Pillow 36935.4/63371: 58% mana arcane_charge(4)
2:55.444 aoe o arcane_explosion Fluffy_Pillow 41128.0/63371: 65% mana
2:56.751 aoe n shifting_power Fluffy_Pillow 37784.6/63371: 60% mana arcane_charge
3:00.435 aoe o arcane_explosion Fluffy_Pillow 41575.0/65943: 63% mana arcane_charge, redirected_anima(6)
3:01.741 aoe o arcane_explosion Fluffy_Pillow 38297.4/65943: 58% mana arcane_charge(2), clearcasting, redirected_anima(6)
3:03.047 aoe o arcane_explosion Fluffy_Pillow 40019.8/65943: 61% mana arcane_charge(3), redirected_anima(6)
3:04.356 aoe p arcane_barrage Fluffy_Pillow 36746.2/65943: 56% mana arcane_charge(4), redirected_anima(6)
3:05.662 aoe m arcane_orb Fluffy_Pillow 41106.4/65943: 62% mana redirected_anima(6)
3:06.970 aoe p arcane_barrage Fluffy_Pillow 42331.4/65943: 64% mana arcane_charge(4), redirected_anima(6)
3:08.278 aoe o arcane_explosion Fluffy_Pillow 46694.2/65943: 71% mana redirected_anima(6)
3:09.586 aoe o arcane_explosion Fluffy_Pillow 43419.3/65943: 66% mana arcane_charge, redirected_anima(6)
3:10.891 aoe o arcane_explosion Fluffy_Pillow 40140.4/65943: 61% mana arcane_charge(2), redirected_anima(6)
3:12.196 aoe o arcane_explosion Fluffy_Pillow 37101.0/66371: 56% mana arcane_charge(3), redirected_anima(7)
3:13.502 aoe p arcane_barrage Fluffy_Pillow 33834.7/66371: 51% mana arcane_charge(4), clearcasting, redirected_anima(7)
3:14.809 aoe j touch_of_the_magi Fluffy_Pillow 38224.5/66371: 58% mana clearcasting, redirected_anima(7)
3:16.116 aoe k arcane_power Fluffy_Pillow 37459.4/66371: 56% mana arcane_charge(4), clearcasting, redirected_anima(7)
3:16.116 shared_cds t berserking Fluffy_Pillow 37459.4/66371: 56% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima(7)
3:16.116 aoe p arcane_barrage Fluffy_Pillow 37459.4/66371: 56% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima(7)
3:17.304 aoe o arcane_explosion Fluffy_Pillow 41691.3/66371: 63% mana berserking, arcane_power, clearcasting, rune_of_power, redirected_anima(7)
3:18.494 aoe o arcane_explosion Fluffy_Pillow 43270.9/66371: 65% mana berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima(7)
3:19.683 aoe o arcane_explosion Fluffy_Pillow 42349.2/66371: 64% mana berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima(7)
3:20.873 aoe o arcane_explosion Fluffy_Pillow 41696.4/66800: 62% mana berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima(8)
3:22.061 aoe p arcane_barrage Fluffy_Pillow 40783.5/66800: 61% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(8)
3:23.249 aoe o arcane_explosion Fluffy_Pillow 45042.7/66800: 67% mana berserking, arcane_power, rune_of_power, redirected_anima(8)
3:24.438 aoe o arcane_explosion Fluffy_Pillow 44131.2/66800: 66% mana berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima(8)
3:25.626 aoe o arcane_explosion Fluffy_Pillow 43218.4/66800: 65% mana berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, redirected_anima(8)
3:26.815 aoe o arcane_explosion Fluffy_Pillow 43082.1/64229: 67% mana berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima(2)
3:28.005 aoe p arcane_barrage Fluffy_Pillow 42110.7/64229: 66% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(2)
3:29.193 aoe m arcane_orb Fluffy_Pillow 46205.9/64229: 72% mana arcane_power, rune_of_power, redirected_anima(2)
3:30.501 aoe p arcane_barrage Fluffy_Pillow 47636.1/64229: 74% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(2)
3:31.905 aoe o arcane_explosion Fluffy_Pillow 52008.8/64229: 81% mana redirected_anima(2)
3:33.210 aoe o arcane_explosion Fluffy_Pillow 48685.2/64229: 76% mana arcane_charge, redirected_anima(2)
3:34.517 aoe o arcane_explosion Fluffy_Pillow 45364.1/64229: 71% mana arcane_charge(2), redirected_anima(2)
3:35.823 aoe o arcane_explosion Fluffy_Pillow 42041.8/64229: 65% mana arcane_charge(3), redirected_anima(2)
3:37.131 aoe l rune_of_power Fluffy_Pillow 38722.0/64229: 60% mana arcane_charge(4), redirected_anima(2)
3:38.437 aoe p arcane_barrage Fluffy_Pillow 40399.6/64229: 63% mana arcane_charge(4), rune_of_power, redirected_anima(2)
3:39.744 aoe o arcane_explosion Fluffy_Pillow 44647.7/64229: 70% mana rune_of_power, redirected_anima(2)
3:41.052 aoe o arcane_explosion Fluffy_Pillow 41052.2/63800: 64% mana arcane_charge, rune_of_power, redirected_anima
3:42.359 aoe o arcane_explosion Fluffy_Pillow 37719.9/63800: 59% mana arcane_charge(2), rune_of_power, redirected_anima
3:43.664 aoe o arcane_explosion Fluffy_Pillow 34385.1/63800: 54% mana arcane_charge(3), rune_of_power, redirected_anima
3:44.971 aoe p arcane_barrage Fluffy_Pillow 31052.8/63800: 49% mana arcane_charge(4), rune_of_power, redirected_anima
3:46.278 aoe o arcane_explosion Fluffy_Pillow 35272.6/63800: 55% mana rune_of_power, redirected_anima
3:47.586 aoe o arcane_explosion Fluffy_Pillow 31941.6/63800: 50% mana arcane_charge, rune_of_power, redirected_anima
3:48.891 aoe o arcane_explosion Fluffy_Pillow 28606.7/63800: 45% mana arcane_charge(2), rune_of_power, redirected_anima
3:50.197 aoe o arcane_explosion Fluffy_Pillow 25103.4/63371: 40% mana arcane_charge(3), clearcasting, rune_of_power
3:51.502 aoe p arcane_barrage Fluffy_Pillow 26757.4/63371: 42% mana arcane_charge(4), rune_of_power
3:52.809 aoe m arcane_orb Fluffy_Pillow 30948.8/63371: 49% mana rune_of_power
3:54.115 aoe n shifting_power Fluffy_Pillow 32104.1/63371: 51% mana arcane_charge(4)
3:57.871 aoe p arcane_barrage Fluffy_Pillow 35991.3/66371: 54% mana arcane_charge(4), redirected_anima(7)
3:59.179 aoe o arcane_explosion Fluffy_Pillow 40382.5/66371: 61% mana redirected_anima(7)
4:00.486 aoe o arcane_explosion Fluffy_Pillow 37117.4/66371: 56% mana arcane_charge, redirected_anima(7)
4:01.794 aoe o arcane_explosion Fluffy_Pillow 33853.7/66371: 51% mana arcane_charge(2), redirected_anima(7)
4:03.102 aoe o arcane_explosion Fluffy_Pillow 30590.0/66371: 46% mana arcane_charge(3), redirected_anima(7)
4:04.409 aoe p arcane_barrage Fluffy_Pillow 27324.9/66371: 41% mana arcane_charge(4), redirected_anima(7)
4:05.717 aoe m arcane_orb Fluffy_Pillow 31716.1/66371: 48% mana redirected_anima(7)
4:07.025 aoe p arcane_barrage Fluffy_Pillow 32952.3/66371: 50% mana arcane_charge(4), redirected_anima(7)
4:08.331 aoe o arcane_explosion Fluffy_Pillow 37340.8/66371: 56% mana redirected_anima(7)
4:09.637 aoe o arcane_explosion Fluffy_Pillow 34074.4/66371: 51% mana arcane_charge, clearcasting, redirected_anima(7)
4:10.944 aoe j touch_of_the_magi Fluffy_Pillow 35809.4/66371: 54% mana arcane_charge(2), redirected_anima(7)
4:12.252 aoe l rune_of_power Fluffy_Pillow 35045.7/66371: 53% mana arcane_charge(4), redirected_anima(7)
4:13.559 aoe p arcane_barrage Fluffy_Pillow 36780.6/66371: 55% mana arcane_charge(4), rune_of_power, redirected_anima(7)
4:14.866 aoe o arcane_explosion Fluffy_Pillow 41170.4/66371: 62% mana rune_of_power, redirected_anima(7)
4:16.172 aoe o arcane_explosion Fluffy_Pillow 37904.0/66371: 57% mana arcane_charge, rune_of_power, redirected_anima(7)
4:17.479 aoe o arcane_explosion Fluffy_Pillow 34639.0/66371: 52% mana arcane_charge(2), rune_of_power, redirected_anima(7)
4:18.786 aoe o arcane_explosion Fluffy_Pillow 31373.9/66371: 47% mana arcane_charge(3), clearcasting, rune_of_power, redirected_anima(7)
4:20.093 aoe p arcane_barrage Fluffy_Pillow 33108.9/66371: 50% mana arcane_charge(4), rune_of_power, redirected_anima(7)
4:21.401 aoe o arcane_explosion Fluffy_Pillow 37500.0/66371: 57% mana rune_of_power, redirected_anima(7)
4:22.707 aoe o arcane_explosion Fluffy_Pillow 34233.6/66371: 52% mana arcane_charge, rune_of_power, redirected_anima(7)
4:24.012 shared_cds r use_mana_gem NightFae_Niya 30965.9/66371: 47% mana arcane_charge(2), rune_of_power, redirected_anima(7)
4:24.090 aoe o arcane_explosion Fluffy_Pillow 37706.6/66371: 57% mana arcane_charge(2), rune_of_power, redirected_anima(7)
4:25.396 aoe o arcane_explosion Fluffy_Pillow 32883.5/63371: 52% mana arcane_charge(3), clearcasting, rune_of_power
4:26.703 aoe p arcane_barrage Fluffy_Pillow 34540.1/63371: 55% mana arcane_charge(4), rune_of_power
4:28.010 aoe m arcane_orb Fluffy_Pillow 38731.5/63371: 61% mana rune_of_power
4:29.317 aoe p arcane_barrage Fluffy_Pillow 39888.0/63371: 63% mana arcane_charge(4)
4:30.623 aoe o arcane_explosion Fluffy_Pillow 44078.1/63371: 70% mana
4:31.930 aoe o arcane_explosion Fluffy_Pillow 40734.6/63371: 64% mana arcane_charge, clearcasting
4:33.237 aoe o arcane_explosion Fluffy_Pillow 42391.2/63371: 67% mana arcane_charge(2)
4:34.541 aoe o arcane_explosion Fluffy_Pillow 39043.9/63371: 62% mana arcane_charge(3)
4:35.846 aoe p arcane_barrage Fluffy_Pillow 35697.9/63371: 56% mana arcane_charge(4)
4:37.155 aoe o arcane_explosion Fluffy_Pillow 39891.8/63371: 63% mana
4:38.461 aoe o arcane_explosion Fluffy_Pillow 36547.1/63371: 58% mana arcane_charge
4:39.769 aoe n shifting_power Fluffy_Pillow 33204.9/63371: 52% mana arcane_charge(2)
4:43.517 aoe o arcane_explosion Fluffy_Pillow 36893.9/65943: 56% mana arcane_charge(2), redirected_anima(6)
4:44.823 aoe o arcane_explosion Fluffy_Pillow 33616.3/65943: 51% mana arcane_charge(3), redirected_anima(6)
4:46.130 aoe p arcane_barrage Fluffy_Pillow 30340.0/65943: 46% mana arcane_charge(4), redirected_anima(6)
4:47.435 aoe m arcane_orb Fluffy_Pillow 34698.8/65943: 53% mana redirected_anima(6)
4:48.742 aoe p arcane_barrage Fluffy_Pillow 35922.6/65943: 54% mana arcane_charge(4), redirected_anima(6)
4:50.048 aoe o arcane_explosion Fluffy_Pillow 40282.7/65943: 61% mana redirected_anima(6)
4:51.355 aoe j touch_of_the_magi Fluffy_Pillow 37006.5/65943: 56% mana arcane_charge, redirected_anima(6)
4:52.661 aoe k arcane_power Fluffy_Pillow 36228.9/65943: 55% mana arcane_charge(4), redirected_anima(6)
4:52.661 aoe p arcane_barrage Fluffy_Pillow 36228.9/65943: 55% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
4:53.966 aoe o arcane_explosion Fluffy_Pillow 40587.7/65943: 62% mana arcane_power, rune_of_power, redirected_anima(6)
4:55.270 aoe o arcane_explosion Fluffy_Pillow 39807.5/65943: 60% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(6)
4:56.575 aoe o arcane_explosion Fluffy_Pillow 39028.6/65943: 59% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(6)
4:57.881 aoe o arcane_explosion Fluffy_Pillow 38251.1/65943: 58% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(6)
4:59.188 aoe p arcane_barrage Fluffy_Pillow 37474.8/65943: 57% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima(6)
5:00.494 aoe o arcane_explosion Fluffy_Pillow 41834.9/65943: 63% mana arcane_power, clearcasting, rune_of_power, redirected_anima(6)
5:01.802 shared_cds s potion Fluffy_Pillow 43560.0/65943: 66% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(6)
5:01.802 aoe o arcane_explosion Fluffy_Pillow 43560.0/65943: 66% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(6), potion_of_deathly_fixation
5:03.109 aoe o arcane_explosion Fluffy_Pillow 42783.8/65943: 65% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(6), potion_of_deathly_fixation
5:04.416 aoe o arcane_explosion Fluffy_Pillow 42007.5/65943: 64% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(6), potion_of_deathly_fixation
5:05.723 aoe p arcane_barrage Fluffy_Pillow 41499.2/66371: 63% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(7), potion_of_deathly_fixation
5:07.029 aoe o arcane_explosion Fluffy_Pillow 45887.7/66371: 69% mana arcane_power, rune_of_power, redirected_anima(7), potion_of_deathly_fixation
5:08.336 aoe o arcane_explosion Fluffy_Pillow 45122.6/66371: 68% mana arcane_charge, redirected_anima(7), potion_of_deathly_fixation
5:09.642 aoe o arcane_explosion Fluffy_Pillow 41856.3/66371: 63% mana arcane_charge(2), redirected_anima(7), potion_of_deathly_fixation
5:10.947 aoe o arcane_explosion Fluffy_Pillow 37093.5/63800: 58% mana arcane_charge(3), redirected_anima, potion_of_deathly_fixation
5:12.254 aoe l rune_of_power Fluffy_Pillow 33761.3/63800: 53% mana arcane_charge(4), redirected_anima, potion_of_deathly_fixation
5:13.561 aoe p arcane_barrage Fluffy_Pillow 35429.0/63800: 56% mana arcane_charge(4), rune_of_power, redirected_anima, potion_of_deathly_fixation
5:14.867 aoe m arcane_orb Fluffy_Pillow 39647.4/63800: 62% mana rune_of_power, redirected_anima, potion_of_deathly_fixation
5:16.174 aoe p arcane_barrage Fluffy_Pillow 40815.2/63800: 64% mana arcane_charge(4), rune_of_power, redirected_anima, potion_of_deathly_fixation
5:17.481 aoe o arcane_explosion Fluffy_Pillow 45034.9/63800: 71% mana rune_of_power, redirected_anima, potion_of_deathly_fixation
5:18.788 aoe o arcane_explosion Fluffy_Pillow 41702.6/63800: 65% mana arcane_charge, rune_of_power, redirected_anima, potion_of_deathly_fixation
5:20.093 aoe o arcane_explosion Fluffy_Pillow 38367.8/63800: 60% mana arcane_charge(2), rune_of_power, redirected_anima, potion_of_deathly_fixation
5:21.398 aoe o arcane_explosion Fluffy_Pillow 35033.0/63800: 55% mana arcane_charge(3), rune_of_power, redirected_anima, potion_of_deathly_fixation
5:22.704 aoe p arcane_barrage Fluffy_Pillow 31699.5/63800: 50% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima, potion_of_deathly_fixation
5:24.010 aoe o arcane_explosion Fluffy_Pillow 35917.9/63800: 56% mana clearcasting, rune_of_power, redirected_anima, potion_of_deathly_fixation
5:25.317 aoe o arcane_explosion Fluffy_Pillow 37585.6/63800: 59% mana arcane_charge, rune_of_power, redirected_anima, potion_of_deathly_fixation
5:26.623 aoe o arcane_explosion Fluffy_Pillow 34252.1/63800: 54% mana arcane_charge(2), rune_of_power, redirected_anima, potion_of_deathly_fixation
5:27.931 aoe o arcane_explosion Fluffy_Pillow 30921.1/63800: 48% mana arcane_charge(3), rune_of_power, redirected_anima

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Niya"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=322721//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Nadjia : 11024 dps, 4785 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11024.1 11024.1 17.5 / 0.158% 1167.5 / 10.6% 5.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2092.4 1991.8 Mana 0.00% 50.4 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 11024
Arcane Barrage 4064 36.9% 57.7 5.20sec 21187 17333 Direct 173.0 5930 11865 7073 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.74 172.96 0.00 0.00 1.2224 0.0000 1223241.65 1223241.65 0.00% 17332.51 17332.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 139.61 98 182 5929.71 2082 25140 5921.00 5038 6474 827621 827621 0.00%
crit 19.28% 33.35 17 56 11865.17 4164 50280 11853.14 7709 17454 395620 395620 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.72
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [s]:0.01
Arcane Blast 0 0.0% 0.0 0.00sec 1324 1183 Direct 0.0 1324 0 1324 0.0%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.9580 0.0000 1.18 1.18 0.00% 1183.38 1183.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 0.00 0 1 1324.21 1324 1324 1.18 0 1324 1 1 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    rotation
    [r]:0.00
Arcane Echo 277 2.5% 43.4 6.40sec 1915 0 Direct 130.1 534 1071 638 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.37 130.12 0.00 0.00 0.0000 0.0000 83044.36 83044.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 104.91 71 133 534.36 316 664 533.64 495 556 56050 56050 0.00%
crit 19.37% 25.20 11 46 1071.25 633 1329 1070.06 908 1223 26995 26995 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4792 43.4% 157.1 1.88sec 9166 7530 Direct 471.3 2564 5110 3056 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 157.10 471.29 0.00 0.00 1.2173 0.0000 1440008.54 1440008.54 0.00% 7530.28 7530.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 380.25 291 473 2564.33 1958 4112 2564.87 2462 2676 974988 974988 0.00%
crit 19.32% 91.04 53 131 5109.53 3916 8223 5109.44 4405 5716 465020 465020 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:157.10
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (851) 0.0% (7.7%) 13.2 23.41sec 19359 15725

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.21 0.00 0.00 0.00 1.2311 0.0000 0.00 0.00 0.00% 15724.65 15724.65

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.21
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 851 7.7% 39.6 23.41sec 6462 0 Direct 39.6 5434 10826 6464 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.58 39.58 0.00 0.00 0.0000 0.0000 255761.45 255761.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.90% 32.02 19 44 5433.68 3869 8126 5431.02 4779 5956 173948 173948 0.00%
crit 19.10% 7.56 1 18 10826.23 7739 16251 10846.24 7739 16251 81814 81814 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.6%) 14.8 1.76sec 1389 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.6% 14.8 1.76sec 1389 0 Direct 14.8 1164 2327 1389 19.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.80 14.80 0.00 0.00 0.0000 0.0000 20544.28 20544.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 11.93 5 22 1163.53 1164 1164 1163.53 1164 1164 13885 13885 0.00%
crit 19.34% 2.86 0 10 2327.06 2327 2327 2223.08 0 2327 6659 6659 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1764 19.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1762.52 1762.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.97% 0.81 0 1 1480.68 1481 1481 1198.83 0 1481 1199 1199 0.00%
crit 19.03% 0.19 0 1 2961.35 2961 2961 563.69 0 2961 564 564 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.2%) 1.0 0.00sec 6105 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 153  / 21 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6104.76 6104.76 0.00% 51.83 51.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 72.52 57 83 56.80 43 60 56.80 56 58 4119 4119 0.00%
crit 19.43% 17.48 7 33 113.56 86 120 113.56 102 120 1986 1986 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (158) 0.0% (1.4%) 2.9 128.43sec 16508 13413

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 1.2309 0.0000 0.00 0.00 0.00% 13413.36 13413.36

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.88
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 70 0.6% 5.7 52.55sec 3689 0 Direct 5.7 3098 6205 3690 19.0%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.67 5.67 0.00 0.00 0.0000 0.0000 20915.75 20915.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.96% 4.59 0 6 3098.17 1739 3651 3084.19 0 3651 14217 14217 0.00%
crit 19.04% 1.08 0 5 6204.70 3477 7302 4318.44 0 7302 6699 6699 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 88 0.8% 2.8 130.29sec 9577 0 Direct 2.8 8104 15980 9588 18.7%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 2.77 0.00 0.00 0.0000 0.0000 26513.90 26513.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.28% 2.25 0 3 8103.80 6126 9188 8019.13 0 9188 18232 18232 0.00%
crit 18.72% 0.52 0 3 15980.12 12251 18377 6968.55 0 18377 8282 8282 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (787) 0.0% (7.1%) 6.2 51.73sec 38348 31435

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.16 0.00 0.00 0.00 1.2200 0.0000 0.00 0.00 0.00% 31435.16 31435.16

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.19
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 787 7.1% 6.2 51.64sec 38348 0 Direct 18.4 12820 0 12820 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.16 18.45 0.00 0.00 0.0000 0.0000 236392.40 236392.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.45 15 21 12819.92 2767 52306 12809.75 8813 17696 236392 236392 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10179.26
  • base_dd_max:10179.26
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Nadjia
Arcane Power 2.9 127.17sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.86
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 254.27sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.86
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 160.07sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.16 0.00 6.86 0.00 4.1597 0.6985 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:1.15
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 50.68sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.98 0.00 0.00 0.00 1.2200 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.00
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 124.10sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.5 157.6 5.1sec 1.4sec 3.8sec 73.46% 0.00% 1.0 (1.7) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.2s

Stack Uptimes

  • arcane_charge_1:18.76%
  • arcane_charge_2:17.01%
  • arcane_charge_3:16.46%
  • arcane_charge_4:21.23%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.3sec 127.3sec 14.7sec 14.00% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.3s / 134.3s
  • trigger_min/max:121.3s / 134.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:14.00%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 254.5sec 254.5sec 11.7sec 7.20% 12.72% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:251.7s / 261.4s
  • trigger_min/max:251.7s / 261.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.20%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 25.0 0.2 11.6sec 11.6sec 1.9sec 15.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.81%
  • clearcasting_2:0.15%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.18% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.0s

Stack Uptimes

  • euphoria_1:11.18%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 1.2 0.0 175.2sec 175.2sec 4.2sec 1.60% 0.00% 4.6 (4.6) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.7s / 259.2s
  • trigger_min/max:90.7s / 259.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:1.60%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.42% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.42%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.3sec 35.3sec 14.7sec 43.18% 0.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 51.8s
  • trigger_min/max:15.7s / 51.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:43.18%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 145.5 78.0sec 2.0sec 66.5sec 97.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.92%
  • thrill_seeker_3:2.91%
  • thrill_seeker_4:2.90%
  • thrill_seeker_5:2.88%
  • thrill_seeker_6:2.85%
  • thrill_seeker_7:2.83%
  • thrill_seeker_8:2.80%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.75%
  • thrill_seeker_11:2.73%
  • thrill_seeker_12:2.70%
  • thrill_seeker_13:2.68%
  • thrill_seeker_14:2.66%
  • thrill_seeker_15:2.63%
  • thrill_seeker_16:2.61%
  • thrill_seeker_17:2.59%
  • thrill_seeker_18:2.57%
  • thrill_seeker_19:2.55%
  • thrill_seeker_20:2.53%
  • thrill_seeker_21:2.51%
  • thrill_seeker_22:2.49%
  • thrill_seeker_23:2.47%
  • thrill_seeker_24:2.45%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.42%
  • thrill_seeker_27:2.41%
  • thrill_seeker_28:2.40%
  • thrill_seeker_29:2.39%
  • thrill_seeker_30:2.37%
  • thrill_seeker_31:2.36%
  • thrill_seeker_32:2.35%
  • thrill_seeker_33:2.34%
  • thrill_seeker_34:2.32%
  • thrill_seeker_35:2.31%
  • thrill_seeker_36:2.30%
  • thrill_seeker_37:2.29%
  • thrill_seeker_38:2.28%
  • thrill_seeker_39:2.27%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.00% 0.00% 1.72%
Arcane Barrage Arcane Charge 2 0.00% 0.00% 1.72%
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.75%
Arcane Barrage Arcane Charge 4 99.99% 96.55% 100.00%
Arcane Blast Arcane Charge 0 0.09% 0.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.42% 0.77% 8.22% 0.8s 0.0s 4.9s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.737120.053239.903
Evocation140.0660.715330.091213.674138.469330.091
Rune of Power6.6520.01026.87541.99222.71454.006
Touch of the Magi4.9760.00025.26432.89621.40852.296
Arcane Power5.5431.30914.25316.0799.46223.734
Arcane Barrage2.7570.0008.928160.319125.804194.403
Arcane Orb3.4060.01410.48345.25632.22059.006
Mirrors of Torment24.8250.00071.48472.41566.886138.662

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
mana_regen Mana 530.64 369041.28 61.62% 695.46 11484.22 3.02%
Evocation Mana 53.32 55339.85 9.24% 1037.89 0.00 0.00%
Mana Gem Mana 2.75 17453.66 2.91% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.73 139474.39 23.29% 2416.03 6852.75 4.68%
Mirrors of Torment Mana 8.45 17605.06 2.94% 2084.47 3803.88 17.77%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1991.80 2092.43 22134.3 33106.0 389.6 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
arcane_blast Mana 0.0 1.2 1375.0 1355.6 1.0
arcane_explosion Mana 157.1 601176.2 3826.6 3826.8 2.4
arcane_orb Mana 13.2 5905.7 447.1 447.0 43.3
mirrors_of_torment Mana 2.9 5749.8 2000.0 2001.2 8.2
touch_of_the_magi Mana 6.2 15404.2 2499.8 2498.9 15.3

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Venthyr_Nadjia Damage Per Second
Count 1119
Mean 11024.08
Minimum 10060.90
Maximum 11881.62
Spread ( max - min ) 1820.72
Range [ ( max - min ) / 2 * 100% ] 8.26%
Standard Deviation 298.0156
5th Percentile 10537.25
95th Percentile 11500.24
( 95th Percentile - 5th Percentile ) 962.99
Mean Distribution
Standard Deviation 8.9089
95.00% Confidence Interval ( 11006.62 - 11041.54 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2808
0.1 Scale Factor Error with Delta=300 759
0.05 Scale Factor Error with Delta=300 3033
0.01 Scale Factor Error with Delta=300 75817
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 1119
Mean 4784.82
Minimum 4282.69
Maximum 5458.31
Spread ( max - min ) 1175.62
Range [ ( max - min ) / 2 * 100% ] 12.28%
Standard Deviation 177.5114
5th Percentile 4507.40
95th Percentile 5072.54
( 95th Percentile - 5th Percentile ) 565.14
Mean Distribution
Standard Deviation 5.3065
95.00% Confidence Interval ( 4774.42 - 4795.22 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5288
0.1 Scale Factor Error with Delta=300 269
0.05 Scale Factor Error with Delta=300 1076
0.01 Scale Factor Error with Delta=300 26899
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 1119
Mean 11024.08
Minimum 10060.90
Maximum 11881.62
Spread ( max - min ) 1820.72
Range [ ( max - min ) / 2 * 100% ] 8.26%
Damage
Venthyr_Nadjia Damage
Count 1119
Mean 3308186.03
Minimum 2553283.47
Maximum 4065740.22
Spread ( max - min ) 1512456.75
Range [ ( max - min ) / 2 * 100% ] 22.86%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.88 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.19 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.86 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.00 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.21 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 157.10 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.72 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 1.15 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
0.00 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
r 0.00 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
s 0.01 arcane_barrage
actions.shared_cds
# count action,conditions
t 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.86 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkluvpnpoooopoooopoooompoootopnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooqolpoooopnpoooopoootopojkmpnpoooopoooopoooopnpoooopoooopoooopkmpnpoooopoooopoooopnpoooopoooopooqjklvpnpoooopoooopoootompnpoooopoooopoooopnpoooopoooopoooopkmpnpo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana clearcasting
0:01.307 aoe k touch_of_the_magi Fluffy_Pillow 61377.8/63371: 97% mana bloodlust, clearcasting
0:02.313 aoe l arcane_power Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, arcane_charge(4), clearcasting, thrill_seeker
0:02.313 shared_cds u potion Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker
0:02.313 shared_cds v berserking Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:02.313 aoe p arcane_barrage Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:03.228 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting(2), rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:04.142 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.057 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting(2), rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.972 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:06.886 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:07.800 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:08.716 aoe p arcane_barrage Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:09.631 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:10.545 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:11.460 aoe o arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:12.376 aoe o arcane_explosion Fluffy_Pillow 59350.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:13.291 aoe p arcane_barrage Fluffy_Pillow 58010.2/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:14.207 aoe o arcane_explosion Fluffy_Pillow 61706.0/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(8), potion_of_deathly_fixation
0:15.122 aoe o arcane_explosion Fluffy_Pillow 62900.6/63371: 99% mana bloodlust, arcane_charge, arcane_power, rune_of_power, thrill_seeker(8), potion_of_deathly_fixation
0:16.129 aoe o arcane_explosion Fluffy_Pillow 61676.9/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(9), potion_of_deathly_fixation
0:17.135 aoe o arcane_explosion Fluffy_Pillow 60451.9/63371: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(9), potion_of_deathly_fixation
0:18.142 aoe m rune_of_power Fluffy_Pillow 59228.2/63371: 93% mana bloodlust, arcane_charge(4), thrill_seeker(10), potion_of_deathly_fixation
0:19.147 aoe p arcane_barrage Fluffy_Pillow 60502.0/63371: 95% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(10), potion_of_deathly_fixation
0:20.155 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:21.161 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:22.168 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:23.173 shared_cds t use_mana_gem Venthyr_Nadjia 52196.5/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:23.173 aoe o arcane_explosion Fluffy_Pillow 58533.7/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:24.178 aoe p arcane_barrage Fluffy_Pillow 54807.4/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:25.184 aoe n arcane_orb Fluffy_Pillow 58617.3/63371: 92% mana bloodlust, rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:26.192 aoe p arcane_barrage Fluffy_Pillow 59394.9/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:27.199 aoe o arcane_explosion Fluffy_Pillow 63206.1/63371: 100% mana bloodlust, rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:28.208 aoe o arcane_explosion Fluffy_Pillow 59484.9/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power, thrill_seeker(15)
0:29.213 aoe o arcane_explosion Fluffy_Pillow 60758.7/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power, thrill_seeker(15)
0:30.220 aoe o arcane_explosion Fluffy_Pillow 57035.0/63371: 90% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(16)
0:31.227 aoe p arcane_barrage Fluffy_Pillow 58311.3/63371: 92% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(16)
0:32.234 aoe o arcane_explosion Fluffy_Pillow 62122.4/63371: 98% mana bloodlust, rune_of_power, thrill_seeker(17)
0:33.241 aoe o arcane_explosion Fluffy_Pillow 58398.7/63371: 92% mana bloodlust, arcane_charge, clearcasting, rune_of_power, thrill_seeker(17)
0:34.249 aoe o arcane_explosion Fluffy_Pillow 59676.3/63371: 94% mana bloodlust, arcane_charge(2), thrill_seeker(18)
0:35.257 aoe o arcane_explosion Fluffy_Pillow 55953.8/63371: 88% mana bloodlust, arcane_charge(3), clearcasting, thrill_seeker(18)
0:36.264 aoe p arcane_barrage Fluffy_Pillow 57230.1/63371: 90% mana bloodlust, arcane_charge(4), thrill_seeker(19)
0:37.270 aoe o arcane_explosion Fluffy_Pillow 61040.0/63371: 96% mana bloodlust, thrill_seeker(19)
0:38.276 aoe o arcane_explosion Fluffy_Pillow 57315.1/63371: 90% mana bloodlust, arcane_charge, thrill_seeker(20)
0:39.282 aoe o arcane_explosion Fluffy_Pillow 53590.1/63371: 85% mana bloodlust, arcane_charge(2), thrill_seeker(20)
0:40.289 aoe o arcane_explosion Fluffy_Pillow 49866.4/63371: 79% mana bloodlust, arcane_charge(3), thrill_seeker(21)
0:41.296 aoe p arcane_barrage Fluffy_Pillow 46142.7/63371: 73% mana arcane_charge(4), clearcasting, thrill_seeker(21)
0:42.601 aoe o arcane_explosion Fluffy_Pillow 50331.6/63371: 79% mana clearcasting, thrill_seeker(22)
0:43.909 aoe o arcane_explosion Fluffy_Pillow 51989.4/63371: 82% mana arcane_charge, thrill_seeker(22)
0:45.216 aoe o arcane_explosion Fluffy_Pillow 48645.9/63371: 77% mana arcane_charge(2), clearcasting, thrill_seeker(23)
0:46.523 aoe o arcane_explosion Fluffy_Pillow 50302.4/63371: 79% mana arcane_charge(3), thrill_seeker(24)
0:47.829 aoe p arcane_barrage Fluffy_Pillow 46957.7/63371: 74% mana arcane_charge(4), thrill_seeker(24)
0:49.136 aoe n arcane_orb Fluffy_Pillow 51149.1/63371: 81% mana thrill_seeker(25)
0:50.444 aoe p arcane_barrage Fluffy_Pillow 52306.9/63371: 83% mana arcane_charge(4), thrill_seeker(26)
0:51.748 aoe o arcane_explosion Fluffy_Pillow 56494.4/63371: 89% mana thrill_seeker(26)
0:53.054 aoe o arcane_explosion Fluffy_Pillow 53149.7/63371: 84% mana arcane_charge, thrill_seeker(27)
0:54.360 aoe o arcane_explosion Fluffy_Pillow 49805.0/63371: 79% mana arcane_charge(2), thrill_seeker(28)
0:55.666 aoe o arcane_explosion Fluffy_Pillow 46460.2/63371: 73% mana arcane_charge(3), thrill_seeker(28)
0:56.972 aoe p arcane_barrage Fluffy_Pillow 43115.5/63371: 68% mana arcane_charge(4), thrill_seeker(29)
0:58.280 aoe o arcane_explosion Fluffy_Pillow 47308.1/63371: 75% mana thrill_seeker(30)
0:59.588 aoe o arcane_explosion Fluffy_Pillow 43965.9/63371: 69% mana arcane_charge, thrill_seeker(30)
1:00.895 aoe o arcane_explosion Fluffy_Pillow 40622.5/63371: 64% mana arcane_charge(2), thrill_seeker(31)
1:02.202 aoe o arcane_explosion Fluffy_Pillow 37279.0/63371: 59% mana arcane_charge(3), thrill_seeker(32)
1:03.509 aoe p arcane_barrage Fluffy_Pillow 33935.5/63371: 54% mana arcane_charge(4), thrill_seeker(32)
1:04.814 aoe k touch_of_the_magi Fluffy_Pillow 38124.4/63371: 60% mana thrill_seeker(33)
1:06.121 aoe m rune_of_power Fluffy_Pillow 37280.9/63371: 59% mana arcane_charge(4), thrill_seeker(34)
1:07.430 aoe p arcane_barrage Fluffy_Pillow 38940.0/63371: 61% mana arcane_charge(4), rune_of_power, thrill_seeker(34)
1:08.736 aoe o arcane_explosion Fluffy_Pillow 43130.1/63371: 68% mana rune_of_power, thrill_seeker(35)
1:10.043 aoe o arcane_explosion Fluffy_Pillow 39786.6/63371: 63% mana arcane_charge, rune_of_power, thrill_seeker(36)
1:11.348 aoe o arcane_explosion Fluffy_Pillow 36440.6/63371: 58% mana arcane_charge(2), rune_of_power, thrill_seeker(36)
1:12.655 aoe o arcane_explosion Fluffy_Pillow 33097.1/63371: 52% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(37)
1:13.962 aoe p arcane_barrage Fluffy_Pillow 34753.7/63371: 55% mana arcane_charge(4), rune_of_power, thrill_seeker(37)
1:15.270 aoe n arcane_orb Fluffy_Pillow 38946.3/63371: 61% mana rune_of_power, thrill_seeker(38)
1:16.577 aoe p arcane_barrage Fluffy_Pillow 40102.9/63371: 63% mana arcane_charge(4), rune_of_power, thrill_seeker(39)
1:17.883 aoe o arcane_explosion Fluffy_Pillow 44293.0/63371: 70% mana rune_of_power, thrill_seeker(39)
1:19.189 aoe o arcane_explosion Fluffy_Pillow 40948.2/63371: 65% mana arcane_charge, rune_of_power, euphoria
1:20.278 aoe o arcane_explosion Fluffy_Pillow 37328.5/63371: 59% mana arcane_charge(2), rune_of_power, thrill_seeker, euphoria
1:21.367 aoe o arcane_explosion Fluffy_Pillow 33708.7/63371: 53% mana arcane_charge(3), rune_of_power, thrill_seeker, euphoria
1:22.456 aoe p arcane_barrage Fluffy_Pillow 30088.9/63371: 47% mana arcane_charge(4), clearcasting, thrill_seeker(3), euphoria
1:23.545 aoe o arcane_explosion Fluffy_Pillow 34004.0/63371: 54% mana clearcasting, thrill_seeker(3), euphoria
1:24.635 aoe o arcane_explosion Fluffy_Pillow 35385.5/63371: 56% mana arcane_charge, thrill_seeker(4), euphoria
1:25.725 aoe o arcane_explosion Fluffy_Pillow 31767.0/63371: 50% mana arcane_charge(2), thrill_seeker(4), euphoria
1:26.814 aoe o arcane_explosion Fluffy_Pillow 28147.2/63371: 44% mana arcane_charge(3), thrill_seeker(5), euphoria
1:27.902 aoe p arcane_barrage Fluffy_Pillow 24526.2/63371: 39% mana arcane_charge(4), thrill_seeker(5), euphoria
1:28.991 aoe o arcane_explosion Fluffy_Pillow 28441.3/63371: 45% mana thrill_seeker(6)
1:30.298 aoe o arcane_explosion Fluffy_Pillow 25097.8/63371: 40% mana arcane_charge, clearcasting, thrill_seeker(7)
1:31.604 aoe o arcane_explosion Fluffy_Pillow 26753.1/63371: 42% mana arcane_charge(2), thrill_seeker(7)
1:32.910 aoe o arcane_explosion Fluffy_Pillow 23408.3/63371: 37% mana arcane_charge(3), thrill_seeker(8)
1:34.216 aoe p arcane_barrage Fluffy_Pillow 20063.6/63371: 32% mana arcane_charge(4), thrill_seeker(9)
1:35.521 aoe n arcane_orb Fluffy_Pillow 24252.5/63371: 38% mana thrill_seeker(9)
1:36.827 aoe p arcane_barrage Fluffy_Pillow 25407.7/63371: 40% mana arcane_charge(4), thrill_seeker(10)
1:38.132 aoe o arcane_explosion Fluffy_Pillow 29596.6/63371: 47% mana thrill_seeker(11)
1:39.439 aoe o arcane_explosion Fluffy_Pillow 26253.1/63371: 41% mana arcane_charge, thrill_seeker(11)
1:40.747 aoe o arcane_explosion Fluffy_Pillow 22910.9/63371: 36% mana arcane_charge(2), thrill_seeker(12)
1:42.052 aoe o arcane_explosion Fluffy_Pillow 19564.9/63371: 31% mana arcane_charge(3), thrill_seeker(13)
1:43.359 aoe p arcane_barrage Fluffy_Pillow 16221.4/63371: 26% mana arcane_charge(4), thrill_seeker(13)
1:44.667 aoe o arcane_explosion Fluffy_Pillow 20414.1/63371: 32% mana thrill_seeker(14)
1:45.973 aoe o arcane_explosion Fluffy_Pillow 17069.3/63371: 27% mana arcane_charge, thrill_seeker(14)
1:47.281 aoe o arcane_explosion Fluffy_Pillow 13727.1/63371: 22% mana arcane_charge(2), thrill_seeker(15)
1:48.588 aoe o arcane_explosion Fluffy_Pillow 10383.7/63371: 16% mana arcane_charge(3), thrill_seeker(16)
1:49.895 aoe p arcane_barrage Fluffy_Pillow 7040.2/63371: 11% mana arcane_charge(4), thrill_seeker(16)
1:51.202 aoe k touch_of_the_magi Fluffy_Pillow 11231.6/63371: 18% mana thrill_seeker(17)
1:52.506 aoe m rune_of_power Fluffy_Pillow 10384.3/63371: 16% mana arcane_charge(4), thrill_seeker(18)
1:53.813 aoe p arcane_barrage Fluffy_Pillow 12040.8/63371: 19% mana arcane_charge(4), rune_of_power, thrill_seeker(18)
1:55.120 aoe o arcane_explosion Fluffy_Pillow 16232.2/63371: 26% mana rune_of_power, thrill_seeker(19)
1:56.425 aoe o arcane_explosion Fluffy_Pillow 12886.2/63371: 20% mana arcane_charge, rune_of_power, thrill_seeker(20)
1:57.728 aoe o arcane_explosion Fluffy_Pillow 9537.7/63371: 15% mana arcane_charge(2), rune_of_power, thrill_seeker(20)
1:59.035 aoe o arcane_explosion Fluffy_Pillow 6194.2/63371: 10% mana arcane_charge(3), rune_of_power, thrill_seeker(21)
2:00.342 aoe p arcane_barrage Fluffy_Pillow 2850.7/63371: 4% mana arcane_charge(4), rune_of_power, thrill_seeker(22)
2:01.649 aoe n arcane_orb Fluffy_Pillow 7042.1/63371: 11% mana rune_of_power, thrill_seeker(22)
2:02.955 aoe p arcane_barrage Fluffy_Pillow 8197.4/63371: 13% mana arcane_charge(4), rune_of_power, thrill_seeker(23)
2:04.261 aoe o arcane_explosion Fluffy_Pillow 12387.5/63371: 20% mana rune_of_power, thrill_seeker(24)
2:05.567 aoe o arcane_explosion Fluffy_Pillow 9042.8/63371: 14% mana arcane_charge, rune_of_power, thrill_seeker(24)
2:06.875 aoe o arcane_explosion Fluffy_Pillow 5700.5/63371: 9% mana arcane_charge(2), rune_of_power, thrill_seeker(25)
2:08.183 aoe q evocation Venthyr_Nadjia 2358.3/63371: 4% mana arcane_charge(3), rune_of_power, thrill_seeker(26)
2:12.530 aoe o arcane_explosion Fluffy_Pillow 56206.8/63371: 89% mana arcane_charge(3), thrill_seeker(28)
2:13.835 aoe l arcane_power Fluffy_Pillow 52860.8/63371: 83% mana arcane_charge(4), thrill_seeker(28)
2:13.835 aoe p arcane_barrage Fluffy_Pillow 52860.8/63371: 83% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(28)
2:15.141 aoe o arcane_explosion Fluffy_Pillow 57050.9/63371: 90% mana arcane_power, rune_of_power, thrill_seeker(29)
2:16.449 aoe o arcane_explosion Fluffy_Pillow 56208.7/63371: 89% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(30)
2:17.756 aoe o arcane_explosion Fluffy_Pillow 55365.3/63371: 87% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, thrill_seeker(30)
2:19.062 aoe o arcane_explosion Fluffy_Pillow 57020.5/63371: 90% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(31)
2:20.369 aoe p arcane_barrage Fluffy_Pillow 56177.0/63371: 89% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(32)
2:21.674 aoe n arcane_orb Fluffy_Pillow 60365.9/63371: 95% mana arcane_power, rune_of_power, thrill_seeker(32)
2:22.980 aoe p arcane_barrage Fluffy_Pillow 61771.2/63371: 97% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(33)
2:24.287 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_power, rune_of_power, thrill_seeker(34)
2:25.592 aoe o arcane_explosion Fluffy_Pillow 62525.4/63371: 99% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(34)
2:26.900 aoe o arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(35)
2:28.206 aoe o arcane_explosion Fluffy_Pillow 60838.5/63371: 96% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, thrill_seeker(36)
2:29.512 aoe p arcane_barrage Fluffy_Pillow 62493.7/63371: 99% mana arcane_charge(4), thrill_seeker(36)
2:30.818 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana thrill_seeker(37)
2:32.124 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, thrill_seeker(38)
2:33.430 aoe o arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), thrill_seeker(38)
2:34.737 shared_cds t use_mana_gem Venthyr_Nadjia 53338.5/63371: 84% mana arcane_charge(3), thrill_seeker(39)
2:34.737 aoe o arcane_explosion Fluffy_Pillow 59675.6/63371: 94% mana arcane_charge(3), thrill_seeker(39)
2:36.045 aoe p arcane_barrage Fluffy_Pillow 56333.4/63371: 89% mana arcane_charge(4), euphoria
2:37.134 aoe o arcane_explosion Fluffy_Pillow 60248.5/63371: 95% mana euphoria
2:38.222 aoe j mirrors_of_torment Fluffy_Pillow 56627.5/63371: 89% mana arcane_charge, clearcasting, thrill_seeker, euphoria
2:39.312 aoe k touch_of_the_magi Fluffy_Pillow 56009.0/63371: 88% mana arcane_charge, clearcasting, thrill_seeker, euphoria
2:40.400 aoe m rune_of_power Fluffy_Pillow 54887.9/63371: 87% mana arcane_charge(4), clearcasting, thrill_seeker(3), euphoria
2:41.491 aoe p arcane_barrage Fluffy_Pillow 58805.6/63371: 93% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(3), euphoria
2:42.580 aoe n arcane_orb Fluffy_Pillow 62720.6/63371: 99% mana clearcasting, rune_of_power, thrill_seeker(4), euphoria
2:43.671 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(4), euphoria
2:44.762 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power, thrill_seeker(5), euphoria
2:45.852 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, rune_of_power, thrill_seeker(5), euphoria
2:46.939 aoe o arcane_explosion Fluffy_Pillow 62284.0/63371: 98% mana arcane_charge(2), rune_of_power, thrill_seeker(6)
2:48.245 aoe o arcane_explosion Fluffy_Pillow 58939.2/63371: 93% mana arcane_charge(3), rune_of_power, thrill_seeker(7)
2:49.554 aoe p arcane_barrage Fluffy_Pillow 55598.3/63371: 88% mana arcane_charge(4), rune_of_power, thrill_seeker(7)
2:50.858 aoe o arcane_explosion Fluffy_Pillow 59785.9/63371: 94% mana rune_of_power, thrill_seeker(8)
2:52.162 aoe o arcane_explosion Fluffy_Pillow 56438.6/63371: 89% mana arcane_charge, rune_of_power, thrill_seeker(9)
2:53.469 aoe o arcane_explosion Fluffy_Pillow 55630.0/63371: 88% mana arcane_charge(2), rune_of_power, thrill_seeker(9)
2:54.775 aoe o arcane_explosion Fluffy_Pillow 52285.3/63371: 83% mana arcane_charge(3), rune_of_power, thrill_seeker(10)
2:56.081 aoe p arcane_barrage Fluffy_Pillow 48940.5/63371: 77% mana arcane_charge(4), rune_of_power, thrill_seeker(11)
2:57.387 aoe o arcane_explosion Fluffy_Pillow 53130.6/63371: 84% mana thrill_seeker(11)
2:58.694 aoe o arcane_explosion Fluffy_Pillow 49787.2/63371: 79% mana arcane_charge, thrill_seeker(12)
3:00.000 aoe o arcane_explosion Fluffy_Pillow 46442.4/63371: 73% mana arcane_charge(2), thrill_seeker(13)
3:01.306 aoe o arcane_explosion Fluffy_Pillow 43097.7/63371: 68% mana arcane_charge(3), thrill_seeker(13)
3:02.613 aoe p arcane_barrage Fluffy_Pillow 39754.2/63371: 63% mana arcane_charge(4), thrill_seeker(14)
3:03.919 aoe n arcane_orb Fluffy_Pillow 43944.3/63371: 69% mana thrill_seeker(14)
3:05.225 aoe p arcane_barrage Fluffy_Pillow 45099.6/63371: 71% mana arcane_charge(4), thrill_seeker(15)
3:06.531 aoe o arcane_explosion Fluffy_Pillow 49289.7/63371: 78% mana thrill_seeker(16)
3:07.840 aoe o arcane_explosion Fluffy_Pillow 45948.8/63371: 73% mana arcane_charge, thrill_seeker(16)
3:09.146 aoe o arcane_explosion Fluffy_Pillow 42604.1/63371: 67% mana arcane_charge(2), thrill_seeker(17)
3:10.452 aoe o arcane_explosion Fluffy_Pillow 39259.3/63371: 62% mana arcane_charge(3), thrill_seeker(18)
3:11.759 aoe p arcane_barrage Fluffy_Pillow 35915.8/63371: 57% mana arcane_charge(4), thrill_seeker(18)
3:13.066 aoe o arcane_explosion Fluffy_Pillow 40107.2/63371: 63% mana thrill_seeker(19)
3:14.372 aoe o arcane_explosion Fluffy_Pillow 36762.5/63371: 58% mana arcane_charge, thrill_seeker(20)
3:15.679 aoe o arcane_explosion Fluffy_Pillow 33419.0/63371: 53% mana arcane_charge(2), thrill_seeker(20)
3:16.985 aoe o arcane_explosion Fluffy_Pillow 30074.3/63371: 47% mana arcane_charge(3), thrill_seeker(21)
3:18.292 aoe p arcane_barrage Fluffy_Pillow 26730.8/63371: 42% mana arcane_charge(4), thrill_seeker(22)
3:19.599 aoe o arcane_explosion Fluffy_Pillow 30922.2/63371: 49% mana thrill_seeker(22)
3:20.906 aoe o arcane_explosion Fluffy_Pillow 27578.7/63371: 44% mana arcane_charge, thrill_seeker(23)
3:22.213 aoe o arcane_explosion Fluffy_Pillow 24235.3/63371: 38% mana arcane_charge(2), thrill_seeker(24)
3:23.519 aoe o arcane_explosion Fluffy_Pillow 20890.5/63371: 33% mana arcane_charge(3), thrill_seeker(24)
3:24.825 aoe p arcane_barrage Fluffy_Pillow 17545.8/63371: 28% mana arcane_charge(4), clearcasting, thrill_seeker(25)
3:26.131 aoe k touch_of_the_magi Fluffy_Pillow 21735.9/63371: 34% mana clearcasting, thrill_seeker(26)
3:27.436 aoe m rune_of_power Fluffy_Pillow 20889.9/63371: 33% mana arcane_charge(4), clearcasting, thrill_seeker(26)
3:28.744 aoe p arcane_barrage Fluffy_Pillow 22547.7/63371: 36% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(27)
3:30.051 aoe n arcane_orb Fluffy_Pillow 26739.1/63371: 42% mana clearcasting, rune_of_power, thrill_seeker(28)
3:31.358 aoe p arcane_barrage Fluffy_Pillow 27895.6/63371: 44% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(28)
3:32.666 aoe o arcane_explosion Fluffy_Pillow 32088.3/63371: 51% mana clearcasting, rune_of_power, thrill_seeker(29)
3:33.973 aoe o arcane_explosion Fluffy_Pillow 33744.8/63371: 53% mana arcane_charge, rune_of_power, thrill_seeker(29)
3:35.279 aoe o arcane_explosion Fluffy_Pillow 30400.0/63371: 48% mana arcane_charge(2), rune_of_power, thrill_seeker(30)
3:36.585 aoe o arcane_explosion Fluffy_Pillow 27055.3/63371: 43% mana arcane_charge(3), rune_of_power, thrill_seeker(31)
3:37.891 aoe p arcane_barrage Fluffy_Pillow 23710.6/63371: 37% mana arcane_charge(4), rune_of_power, thrill_seeker(31)
3:39.197 aoe o arcane_explosion Fluffy_Pillow 27900.7/63371: 44% mana rune_of_power, thrill_seeker(32)
3:40.504 aoe o arcane_explosion Fluffy_Pillow 24557.2/63371: 39% mana arcane_charge, clearcasting, rune_of_power, thrill_seeker(33)
3:41.812 aoe o arcane_explosion Fluffy_Pillow 26215.0/63371: 41% mana arcane_charge(2), rune_of_power, thrill_seeker(33)
3:43.119 aoe o arcane_explosion Fluffy_Pillow 22871.5/63371: 36% mana arcane_charge(3), rune_of_power, thrill_seeker(34)
3:44.426 aoe p arcane_barrage Fluffy_Pillow 19528.1/63371: 31% mana arcane_charge(4), thrill_seeker(35)
3:45.732 aoe o arcane_explosion Fluffy_Pillow 23718.2/63371: 37% mana thrill_seeker(35)
3:47.040 aoe o arcane_explosion Fluffy_Pillow 20376.0/63371: 32% mana arcane_charge, thrill_seeker(36)
3:48.346 aoe o arcane_explosion Fluffy_Pillow 17031.3/63371: 27% mana arcane_charge(2), thrill_seeker(37)
3:49.652 aoe o arcane_explosion Fluffy_Pillow 13686.5/63371: 22% mana arcane_charge(3), thrill_seeker(37)
3:50.959 aoe p arcane_barrage Fluffy_Pillow 10343.0/63371: 16% mana arcane_charge(4), thrill_seeker(38)
3:52.267 aoe n arcane_orb Fluffy_Pillow 14535.7/63371: 23% mana thrill_seeker(39)
3:53.573 aoe p arcane_barrage Fluffy_Pillow 15691.0/63371: 25% mana arcane_charge(4), thrill_seeker(39)
3:54.878 aoe o arcane_explosion Fluffy_Pillow 19879.8/63371: 31% mana euphoria
3:55.968 aoe o arcane_explosion Fluffy_Pillow 16261.3/63371: 26% mana arcane_charge, clearcasting, euphoria
3:57.058 aoe o arcane_explosion Fluffy_Pillow 17642.8/63371: 28% mana arcane_charge(2), thrill_seeker, euphoria
3:58.148 aoe o arcane_explosion Fluffy_Pillow 14024.3/63371: 22% mana arcane_charge(3), clearcasting, thrill_seeker(3), euphoria
3:59.237 aoe p arcane_barrage Fluffy_Pillow 15404.5/63371: 24% mana arcane_charge(4), thrill_seeker(3), euphoria
4:00.327 aoe o arcane_explosion Fluffy_Pillow 19320.9/63371: 30% mana thrill_seeker(4), euphoria
4:01.417 aoe o arcane_explosion Fluffy_Pillow 15702.4/63371: 25% mana arcane_charge, thrill_seeker(4), euphoria
4:02.508 aoe o arcane_explosion Fluffy_Pillow 12085.1/63371: 19% mana arcane_charge(2), thrill_seeker(5), euphoria
4:03.597 aoe o arcane_explosion Fluffy_Pillow 8465.4/63371: 13% mana arcane_charge(3), thrill_seeker(5), euphoria
4:04.685 aoe p arcane_barrage Fluffy_Pillow 4844.3/63371: 8% mana arcane_charge(4), thrill_seeker(6)
4:05.992 aoe o arcane_explosion Fluffy_Pillow 9035.7/63371: 14% mana thrill_seeker(6)
4:07.300 aoe o arcane_explosion Fluffy_Pillow 5693.5/63371: 9% mana arcane_charge, thrill_seeker(7)
4:08.607 aoe q evocation Fluffy_Pillow 2350.1/63371: 4% mana arcane_charge(2), thrill_seeker(8)
4:12.952 aoe j mirrors_of_torment Fluffy_Pillow 56196.0/63371: 89% mana arcane_charge(2), thrill_seeker(10)
4:14.258 aoe k touch_of_the_magi Fluffy_Pillow 55851.2/63371: 88% mana arcane_charge(2), thrill_seeker(11)
4:15.564 aoe l arcane_power Fluffy_Pillow 55006.5/63371: 87% mana arcane_charge(4), thrill_seeker(11)
4:15.564 shared_cds v berserking Fluffy_Pillow 55006.5/63371: 87% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(11)
4:15.564 aoe p arcane_barrage Fluffy_Pillow 55006.5/63371: 87% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(11)
4:16.753 aoe n arcane_orb Fluffy_Pillow 61583.2/63371: 97% mana berserking, arcane_power, rune_of_power, thrill_seeker(12)
4:17.942 aoe p arcane_barrage Fluffy_Pillow 62840.2/63371: 99% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(12)
4:19.130 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power, thrill_seeker(13)
4:20.317 aoe o arcane_explosion Fluffy_Pillow 62375.9/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(14)
4:21.506 aoe o arcane_explosion Fluffy_Pillow 61382.8/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(14)
4:22.696 aoe o arcane_explosion Fluffy_Pillow 62925.9/63371: 99% mana berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(15)
4:23.885 aoe p arcane_barrage Fluffy_Pillow 61932.9/63371: 98% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(15)
4:25.074 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power, thrill_seeker(16)
4:26.263 aoe o arcane_explosion Fluffy_Pillow 62378.4/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(17)
4:27.452 aoe o arcane_explosion Fluffy_Pillow 61385.4/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(17)
4:28.642 aoe o arcane_explosion Fluffy_Pillow 62928.5/63371: 99% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(18)
4:29.950 aoe p arcane_barrage Fluffy_Pillow 62086.3/63371: 98% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(18)
4:31.257 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana thrill_seeker(19)
4:32.564 aoe o arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, thrill_seeker(20)
4:33.870 aoe o arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2), thrill_seeker(20)
4:35.177 shared_cds t use_mana_gem Venthyr_Nadjia 53339.7/63371: 84% mana arcane_charge(3), thrill_seeker(21)
4:35.177 aoe o arcane_explosion Fluffy_Pillow 59676.9/63371: 94% mana arcane_charge(3), thrill_seeker(21)
4:36.482 aoe m rune_of_power Fluffy_Pillow 56330.9/63371: 89% mana arcane_charge(4), thrill_seeker(22)
4:37.788 aoe p arcane_barrage Fluffy_Pillow 57986.1/63371: 92% mana arcane_charge(4), rune_of_power, thrill_seeker(22)
4:39.094 aoe n arcane_orb Fluffy_Pillow 62176.3/63371: 98% mana rune_of_power, thrill_seeker(23)
4:40.401 aoe p arcane_barrage Fluffy_Pillow 63332.8/63371: 100% mana arcane_charge(4), rune_of_power, thrill_seeker(24)
4:41.708 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, thrill_seeker(24)
4:43.015 aoe o arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, rune_of_power, thrill_seeker(25)
4:44.322 aoe o arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), rune_of_power, thrill_seeker(26)
4:45.626 aoe o arcane_explosion Fluffy_Pillow 53337.2/63371: 84% mana arcane_charge(3), rune_of_power, thrill_seeker(26)
4:46.934 aoe p arcane_barrage Fluffy_Pillow 49995.0/63371: 79% mana arcane_charge(4), rune_of_power, thrill_seeker(27)
4:48.240 aoe o arcane_explosion Fluffy_Pillow 54185.1/63371: 86% mana rune_of_power, thrill_seeker(28)
4:49.547 aoe o arcane_explosion Fluffy_Pillow 50841.7/63371: 80% mana arcane_charge, rune_of_power, thrill_seeker(28)
4:50.853 aoe o arcane_explosion Fluffy_Pillow 47496.9/63371: 75% mana arcane_charge(2), rune_of_power, thrill_seeker(29)
4:52.160 aoe o arcane_explosion Fluffy_Pillow 44153.4/63371: 70% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(30)
4:53.466 aoe p arcane_barrage Fluffy_Pillow 45808.7/63371: 72% mana arcane_charge(4), thrill_seeker(30)
4:54.772 aoe o arcane_explosion Fluffy_Pillow 49998.8/63371: 79% mana thrill_seeker(31)
4:56.078 aoe o arcane_explosion Fluffy_Pillow 46654.1/63371: 74% mana arcane_charge, thrill_seeker(32)
4:57.386 aoe o arcane_explosion Fluffy_Pillow 43311.9/63371: 68% mana arcane_charge(2), thrill_seeker(32)
4:58.692 aoe o arcane_explosion Fluffy_Pillow 39967.1/63371: 63% mana arcane_charge(3), thrill_seeker(33)
4:59.999 aoe p arcane_barrage Fluffy_Pillow 36623.7/63371: 58% mana arcane_charge(4), clearcasting, thrill_seeker(33)
5:01.305 aoe n arcane_orb Fluffy_Pillow 40813.8/63371: 64% mana clearcasting, thrill_seeker(34)
5:02.611 aoe p arcane_barrage Fluffy_Pillow 41969.1/63371: 66% mana arcane_charge(4), clearcasting, thrill_seeker(35)
5:03.918 aoe o arcane_explosion Fluffy_Pillow 46160.4/63371: 73% mana clearcasting, thrill_seeker(35)
5:05.223 aoe o arcane_explosion Fluffy_Pillow 47814.4/63371: 75% mana arcane_charge, thrill_seeker(36)
5:06.529 aoe o arcane_explosion Fluffy_Pillow 44469.7/63371: 70% mana arcane_charge(2), thrill_seeker(37)
5:07.835 aoe o arcane_explosion Fluffy_Pillow 41125.0/63371: 65% mana arcane_charge(3), thrill_seeker(37)
5:09.142 aoe p arcane_barrage Fluffy_Pillow 37781.5/63371: 60% mana arcane_charge(4), thrill_seeker(38)
5:10.449 aoe o arcane_explosion Fluffy_Pillow 41972.9/63371: 66% mana thrill_seeker(39)
5:11.754 aoe o arcane_explosion Fluffy_Pillow 38626.9/63371: 61% mana arcane_charge, thrill_seeker(39)
5:13.062 aoe o arcane_explosion Fluffy_Pillow 35284.7/63371: 56% mana arcane_charge(2), euphoria
5:14.151 aoe o arcane_explosion Fluffy_Pillow 31664.9/63371: 50% mana arcane_charge(3), thrill_seeker, euphoria
5:15.241 aoe p arcane_barrage Fluffy_Pillow 28046.4/63371: 44% mana arcane_charge(4), clearcasting, thrill_seeker, euphoria
5:16.330 aoe o arcane_explosion Fluffy_Pillow 31961.5/63371: 50% mana clearcasting, thrill_seeker(3), euphoria
5:17.420 aoe o arcane_explosion Fluffy_Pillow 33343.0/63371: 53% mana arcane_charge, thrill_seeker(3), euphoria
5:18.509 aoe o arcane_explosion Fluffy_Pillow 29723.2/63371: 47% mana arcane_charge(2), clearcasting, thrill_seeker(4), euphoria
5:19.599 aoe o arcane_explosion Fluffy_Pillow 31104.7/63371: 49% mana arcane_charge(3), thrill_seeker(4), euphoria
5:20.690 aoe p arcane_barrage Fluffy_Pillow 27487.5/63371: 43% mana arcane_charge(4), thrill_seeker(5), euphoria
5:21.781 aoe k touch_of_the_magi Fluffy_Pillow 31405.1/63371: 50% mana thrill_seeker(5), euphoria
5:22.870 aoe m rune_of_power Fluffy_Pillow 30285.3/63371: 48% mana arcane_charge(4), thrill_seeker(6)
5:24.178 aoe p arcane_barrage Fluffy_Pillow 31943.1/63371: 50% mana arcane_charge(4), rune_of_power, thrill_seeker(7)
5:25.484 aoe n arcane_orb Fluffy_Pillow 36133.2/63371: 57% mana rune_of_power, thrill_seeker(7)
5:26.792 aoe p arcane_barrage Fluffy_Pillow 37291.0/63371: 59% mana arcane_charge(4), rune_of_power, thrill_seeker(8)
5:28.097 aoe o arcane_explosion Fluffy_Pillow 41479.9/63371: 65% mana rune_of_power, thrill_seeker(9)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Nadjia"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=331586//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Theotar : 11023 dps, 4774 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11022.8 11022.8 18.6 / 0.168% 1214.5 / 11.0% 5.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2051.5 1965.7 Mana 0.00% 49.5 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 11023
Arcane Barrage 4039 36.7% 57.1 5.26sec 21288 17060 Direct 171.1 5953 11961 7110 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.13 171.14 0.00 0.00 1.2479 0.0000 1216247.98 1216247.98 0.00% 17059.85 17059.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 138.20 101 177 5953.19 2082 26974 5940.72 5225 6547 822408 822408 0.00%
crit 19.25% 32.94 13 52 11961.25 4164 53948 11937.83 7926 16768 393840 393840 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.13
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 271 2.5% 42.8 6.56sec 1904 0 Direct 128.3 533 1064 635 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.77 128.30 0.00 0.00 0.0000 0.0000 81415.27 81415.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 103.69 71 137 532.83 316 664 532.27 490 582 55237 55237 0.00%
crit 19.19% 24.61 9 42 1063.84 633 1329 1062.50 868 1240 26178 26178 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4799 43.5% 154.1 1.92sec 9362 7535 Direct 462.2 2619 5229 3121 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.08 462.25 0.00 0.00 1.2425 0.0000 1442571.76 1442571.76 0.00% 7535.37 7535.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 373.22 286 465 2618.77 1958 4616 2618.96 2506 2764 977208 977208 0.00%
crit 19.26% 89.02 57 133 5229.03 3916 9232 5228.28 4771 5729 465363 465363 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:154.09
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (863) 0.0% (7.8%) 13.2 23.50sec 19730 15823

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.15 0.00 0.00 0.00 1.2470 0.0000 0.00 0.00 0.00% 15822.53 15822.53

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.15
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 863 7.8% 39.4 23.49sec 6586 0 Direct 39.4 5524 11037 6588 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.40 39.40 0.00 0.00 0.0000 0.0000 259473.59 259473.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 31.79 20 45 5523.79 3869 9122 5522.42 4657 6109 175515 175515 0.00%
crit 19.30% 7.60 1 16 11036.67 7739 18245 11034.27 7739 16251 83958 83958 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.6%) 14.7 1.78sec 1392 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.69 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.6% 14.7 1.78sec 1392 0 Direct 14.7 1164 2327 1392 19.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.69 14.69 0.00 0.00 0.0000 0.0000 20450.70 20450.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 11.81 5 19 1163.53 1164 1164 1163.53 1164 1164 13744 13744 0.00%
crit 19.61% 2.88 0 9 2327.06 2327 2327 2229.32 0 2327 6707 6707 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1773 19.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1775.75 1775.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.07% 0.80 0 1 1480.68 1481 1481 1185.60 0 1481 1186 1186 0.00%
crit 19.93% 0.20 0 1 2961.35 2961 2961 590.15 0 2961 590 590 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.2%) 1.0 0.00sec 6095 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 152  / 21 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6094.80 6094.80 0.00% 51.75 51.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 72.70 60 85 56.80 43 60 56.80 56 58 4129 4129 0.00%
crit 19.23% 17.30 5 30 113.60 86 120 113.61 102 120 1966 1966 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (146) 0.0% (1.3%) 2.7 137.68sec 16343 12510

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.69 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 12509.82 12509.82

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.70
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 64 0.6% 5.3 55.09sec 3645 0 Direct 5.3 3040 6072 3651 20.0%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 5.31 0.00 0.00 0.0000 0.0000 19357.25 19357.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.04% 4.25 0 6 3040.34 1739 3651 3019.57 0 3651 12917 12917 0.00%
crit 19.96% 1.06 0 5 6072.39 3477 7302 4153.59 0 7302 6440 6440 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 82 0.7% 2.6 138.69sec 9561 0 Direct 2.6 7993 15980 9563 19.7%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.57 2.57 0.00 0.00 0.0000 0.0000 24589.74 24589.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.33% 2.07 0 3 7992.67 6126 9188 7820.24 0 9188 16510 16510 0.00%
crit 19.67% 0.51 0 3 15979.67 12251 18377 6687.55 0 18377 8080 8080 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (809) 0.0% (7.3%) 6.1 52.91sec 40069 31879

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 1.2570 0.0000 0.00 0.00 0.00% 31878.78 31878.78

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.09
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 809 7.3% 6.1 52.81sec 40069 0 Direct 18.1 13400 0 13400 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 18.14 0.00 0.00 0.0000 0.0000 242884.43 242884.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.14 15 21 13399.57 404 55019 13378.58 8748 17336 242884 242884 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24223.79
  • base_dd_max:24223.79
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Theotar
Arcane Power 2.8 129.27sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.83
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.50sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.83
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.8 170.27sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.83 0.00 4.96 0.00 4.3171 0.7226 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.83
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.9 51.60sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.88 0.00 0.00 0.00 1.2554 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.90
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 124.26sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.8 154.8 5.2sec 1.4sec 3.8sec 72.91% 0.00% 0.4 (0.6) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:18.65%
  • arcane_charge_2:16.35%
  • arcane_charge_3:16.43%
  • arcane_charge_4:21.47%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.4sec 129.4sec 14.7sec 13.80% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.7s / 137.7s
  • trigger_min/max:121.7s / 137.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.80%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.8sec 258.8sec 11.7sec 7.05% 23.55% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:252.8s / 264.5s
  • trigger_min/max:252.8s / 264.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.05%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.4 0.2 11.9sec 11.8sec 2.0sec 16.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.11%
  • clearcasting_2:0.23%
  • clearcasting_3:0.05%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.8 0.0 182.4sec 182.4sec 4.3sec 1.20% 0.00% 3.3 (3.3) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:119.3s / 261.7s
  • trigger_min/max:119.3s / 261.7s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 4.3s

Stack Uptimes

  • evocation_1:1.20%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.42% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.42%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.7 0.0 35.9sec 35.9sec 14.7sec 42.49% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 56.6s
  • trigger_min/max:15.7s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.49%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Soothing Shade 4.2 0.0 62.4sec 62.4sec 11.7sec 16.44% 0.00% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 199.0s
  • trigger_min/max:20.0s / 199.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.44%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.74% 0.77% 7.68% 0.8s 0.0s 4.9s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.737120.053239.903
Evocation177.92029.318350.917240.154139.836358.344
Rune of Power7.4691.14028.61446.33626.62258.197
Touch of the Magi5.8230.00027.30237.86625.31558.160
Arcane Power6.8851.68517.66019.8944.02726.828
Arcane Barrage2.7680.0028.281159.173124.794192.141
Arcane Orb3.4760.00810.48346.10032.43459.903
Mirrors of Torment29.6500.00074.53486.71257.690145.019

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
mana_regen Mana 519.96 376430.08 63.69% 723.96 12951.06 3.33%
Evocation Mana 39.68 40392.49 6.83% 1018.06 0.00 0.00%
Mana Gem Mana 2.73 17616.06 2.98% 6456.00 0.00 0.00%
Arcane Barrage Mana 57.13 140507.08 23.77% 2459.41 7629.61 5.15%
Mirrors of Torment Mana 7.89 16135.22 2.73% 2044.14 4309.84 21.08%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1965.67 2051.47 24872.6 36823.2 638.2 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
arcane_explosion Mana 154.1 589392.1 3825.1 3825.2 2.4
arcane_orb Mana 13.1 5882.6 447.4 447.3 44.1
mirrors_of_torment Mana 2.7 5383.3 2000.0 2002.0 8.2
touch_of_the_magi Mana 6.1 15152.0 2500.0 2499.6 16.0

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Venthyr_Theotar Damage Per Second
Count 1119
Mean 11022.78
Minimum 10038.93
Maximum 12132.96
Spread ( max - min ) 2094.03
Range [ ( max - min ) / 2 * 100% ] 9.50%
Standard Deviation 316.8708
5th Percentile 10502.12
95th Percentile 11551.49
( 95th Percentile - 5th Percentile ) 1049.37
Mean Distribution
Standard Deviation 9.4726
95.00% Confidence Interval ( 11004.21 - 11041.35 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3175
0.1 Scale Factor Error with Delta=300 858
0.05 Scale Factor Error with Delta=300 3429
0.01 Scale Factor Error with Delta=300 85714
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 1119
Mean 4774.03
Minimum 4128.73
Maximum 5517.71
Spread ( max - min ) 1388.99
Range [ ( max - min ) / 2 * 100% ] 14.55%
Standard Deviation 187.1188
5th Percentile 4472.46
95th Percentile 5079.81
( 95th Percentile - 5th Percentile ) 607.36
Mean Distribution
Standard Deviation 5.5937
95.00% Confidence Interval ( 4763.06 - 4784.99 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5902
0.1 Scale Factor Error with Delta=300 299
0.05 Scale Factor Error with Delta=300 1196
0.01 Scale Factor Error with Delta=300 29890
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 1119
Mean 11022.78
Minimum 10038.93
Maximum 12132.96
Spread ( max - min ) 2094.03
Range [ ( max - min ) / 2 * 100% ] 9.50%
Damage
Venthyr_Theotar Damage
Count 1119
Mean 3308766.48
Minimum 2502895.47
Maximum 4041941.97
Spread ( max - min ) 1539046.50
Range [ ( max - min ) / 2 * 100% ] 23.26%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.70 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.09 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.83 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.90 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.15 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 154.09 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.13 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.83 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.83 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklstpnpoooopoooopoooompoooropnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooolpoooopoooropnpoooopoooopjkmpnpoooopoooopoooopnpoooopoooqopnpkmpoooopoooopoooopnpoooopoooopoooopnpjkltpoooopoooopoooompnpoooropoooopoooopnpoooopoooopoooopk

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 61376.5/63371: 97% mana bloodlust
0:02.314 aoe l arcane_power Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), clearcasting
0:02.314 shared_cds s potion Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power
0:02.314 shared_cds t berserking Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:02.314 aoe p arcane_barrage Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:03.231 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.144 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:05.059 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:05.974 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.889 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:07.805 aoe o arcane_explosion Fluffy_Pillow 63192.1/63371: 100% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.719 aoe p arcane_barrage Fluffy_Pillow 61850.5/63371: 98% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.632 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.547 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.464 aoe o arcane_explosion Fluffy_Pillow 60693.4/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.379 aoe o arcane_explosion Fluffy_Pillow 59353.1/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.292 aoe p arcane_barrage Fluffy_Pillow 58010.2/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.207 aoe o arcane_explosion Fluffy_Pillow 61704.8/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.120 aoe o arcane_explosion Fluffy_Pillow 62896.8/63371: 99% mana bloodlust, arcane_charge, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:16.127 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.134 aoe o arcane_explosion Fluffy_Pillow 62147.7/63371: 98% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:18.141 aoe m rune_of_power Fluffy_Pillow 60924.0/63371: 96% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.147 aoe p arcane_barrage Fluffy_Pillow 62199.1/63371: 98% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.153 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.160 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.167 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.174 shared_cds r use_mana_gem Venthyr_Theotar 52200.3/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.174 aoe o arcane_explosion Fluffy_Pillow 58537.5/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.181 aoe p arcane_barrage Fluffy_Pillow 54813.8/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.188 aoe n arcane_orb Fluffy_Pillow 58624.9/63371: 93% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.194 aoe p arcane_barrage Fluffy_Pillow 59400.0/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.201 aoe o arcane_explosion Fluffy_Pillow 63211.1/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.209 aoe o arcane_explosion Fluffy_Pillow 59488.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.215 aoe o arcane_explosion Fluffy_Pillow 55763.7/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.221 aoe o arcane_explosion Fluffy_Pillow 52038.8/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:31.227 aoe p arcane_barrage Fluffy_Pillow 48313.8/63371: 76% mana bloodlust, arcane_charge(4), rune_of_power
0:32.232 aoe o arcane_explosion Fluffy_Pillow 52122.4/63371: 82% mana bloodlust, rune_of_power
0:33.239 aoe o arcane_explosion Fluffy_Pillow 48398.7/63371: 76% mana bloodlust, arcane_charge, rune_of_power
0:34.246 aoe o arcane_explosion Fluffy_Pillow 44675.0/63371: 70% mana bloodlust, arcane_charge(2)
0:35.253 aoe o arcane_explosion Fluffy_Pillow 40951.3/63371: 65% mana bloodlust, arcane_charge(3)
0:36.260 aoe p arcane_barrage Fluffy_Pillow 37227.6/63371: 59% mana bloodlust, arcane_charge(4)
0:37.267 aoe o arcane_explosion Fluffy_Pillow 41038.8/63371: 65% mana bloodlust
0:38.274 aoe o arcane_explosion Fluffy_Pillow 37315.1/63371: 59% mana bloodlust, arcane_charge
0:39.281 aoe o arcane_explosion Fluffy_Pillow 33591.4/63371: 53% mana bloodlust, arcane_charge(2)
0:40.288 aoe o arcane_explosion Fluffy_Pillow 29867.7/63371: 47% mana bloodlust, arcane_charge(3)
0:41.293 aoe p arcane_barrage Fluffy_Pillow 26141.4/63371: 41% mana arcane_charge(4)
0:42.601 aoe o arcane_explosion Fluffy_Pillow 30334.1/63371: 48% mana
0:43.909 aoe o arcane_explosion Fluffy_Pillow 26991.9/63371: 43% mana arcane_charge
0:45.216 aoe o arcane_explosion Fluffy_Pillow 23648.4/63371: 37% mana arcane_charge(2), clearcasting
0:46.523 aoe o arcane_explosion Fluffy_Pillow 25304.9/63371: 40% mana arcane_charge(3)
0:47.830 aoe p arcane_barrage Fluffy_Pillow 21961.5/63371: 35% mana arcane_charge(4)
0:49.137 aoe n arcane_orb Fluffy_Pillow 26152.9/63371: 41% mana
0:50.444 aoe p arcane_barrage Fluffy_Pillow 27309.4/63371: 43% mana arcane_charge(4)
0:51.750 aoe o arcane_explosion Fluffy_Pillow 31499.5/63371: 50% mana
0:53.056 aoe o arcane_explosion Fluffy_Pillow 28154.8/63371: 44% mana arcane_charge
0:54.362 aoe o arcane_explosion Fluffy_Pillow 24810.0/63371: 39% mana arcane_charge(2)
0:55.667 aoe o arcane_explosion Fluffy_Pillow 21464.0/63371: 34% mana arcane_charge(3)
0:56.974 aoe p arcane_barrage Fluffy_Pillow 18120.6/63371: 29% mana arcane_charge(4)
0:58.282 aoe o arcane_explosion Fluffy_Pillow 22313.2/63371: 35% mana
0:59.588 aoe o arcane_explosion Fluffy_Pillow 18968.5/63371: 30% mana arcane_charge, clearcasting
1:00.893 aoe o arcane_explosion Fluffy_Pillow 20622.5/63371: 33% mana arcane_charge(2)
1:02.201 aoe o arcane_explosion Fluffy_Pillow 17280.3/63371: 27% mana arcane_charge(3)
1:03.509 aoe p arcane_barrage Fluffy_Pillow 13938.1/63371: 22% mana arcane_charge(4), clearcasting
1:04.816 aoe k touch_of_the_magi Fluffy_Pillow 18129.4/63371: 29% mana clearcasting
1:06.123 aoe m rune_of_power Fluffy_Pillow 17286.0/63371: 27% mana arcane_charge(4), clearcasting
1:07.429 aoe p arcane_barrage Fluffy_Pillow 18941.2/63371: 30% mana arcane_charge(4), clearcasting(2), rune_of_power
1:08.736 aoe o arcane_explosion Fluffy_Pillow 23132.6/63371: 37% mana clearcasting(2), rune_of_power
1:10.044 aoe o arcane_explosion Fluffy_Pillow 24790.4/63371: 39% mana arcane_charge, clearcasting, rune_of_power
1:11.350 aoe o arcane_explosion Fluffy_Pillow 30201.5/72371: 42% mana arcane_charge(2), rune_of_power, soothing_shade
1:12.656 aoe o arcane_explosion Fluffy_Pillow 27091.8/72371: 37% mana arcane_charge(3), clearcasting, rune_of_power, soothing_shade
1:13.963 aoe p arcane_barrage Fluffy_Pillow 28983.6/72371: 40% mana arcane_charge(4), rune_of_power, soothing_shade
1:15.270 aoe n arcane_orb Fluffy_Pillow 33770.3/72371: 47% mana rune_of_power, soothing_shade
1:16.576 aoe p arcane_barrage Fluffy_Pillow 35160.6/72371: 49% mana arcane_charge(4), clearcasting, rune_of_power, soothing_shade
1:17.883 aoe o arcane_explosion Fluffy_Pillow 39947.3/72371: 55% mana clearcasting, rune_of_power, soothing_shade
1:19.189 aoe o arcane_explosion Fluffy_Pillow 41837.6/72371: 58% mana arcane_charge, rune_of_power, soothing_shade
1:20.497 aoe o arcane_explosion Fluffy_Pillow 38730.8/72371: 54% mana arcane_charge(2), rune_of_power, soothing_shade
1:21.803 aoe o arcane_explosion Fluffy_Pillow 35621.2/72371: 49% mana arcane_charge(3), rune_of_power, soothing_shade
1:23.109 aoe p arcane_barrage Fluffy_Pillow 28468.4/63371: 45% mana arcane_charge(4), clearcasting
1:24.416 aoe o arcane_explosion Fluffy_Pillow 32659.8/63371: 52% mana clearcasting
1:25.721 aoe o arcane_explosion Fluffy_Pillow 34313.8/63371: 54% mana arcane_charge
1:27.026 aoe o arcane_explosion Fluffy_Pillow 30967.8/63371: 49% mana arcane_charge(2), clearcasting
1:28.333 aoe o arcane_explosion Fluffy_Pillow 32624.3/63371: 51% mana arcane_charge(3)
1:29.637 aoe p arcane_barrage Fluffy_Pillow 29277.1/63371: 46% mana arcane_charge(4)
1:30.943 aoe o arcane_explosion Fluffy_Pillow 33467.2/63371: 53% mana
1:32.248 aoe o arcane_explosion Fluffy_Pillow 30121.2/63371: 48% mana arcane_charge, clearcasting
1:33.554 aoe o arcane_explosion Fluffy_Pillow 31776.4/63371: 50% mana arcane_charge(2)
1:34.859 aoe o arcane_explosion Fluffy_Pillow 28430.4/63371: 45% mana arcane_charge(3)
1:36.167 aoe p arcane_barrage Fluffy_Pillow 25088.2/63371: 40% mana arcane_charge(4)
1:37.473 aoe n arcane_orb Fluffy_Pillow 29278.4/63371: 46% mana
1:38.780 aoe p arcane_barrage Fluffy_Pillow 30434.9/63371: 48% mana arcane_charge(4)
1:40.085 aoe o arcane_explosion Fluffy_Pillow 34623.7/63371: 55% mana
1:41.392 aoe o arcane_explosion Fluffy_Pillow 31280.3/63371: 49% mana arcane_charge
1:42.698 aoe o arcane_explosion Fluffy_Pillow 27935.5/63371: 44% mana arcane_charge(2)
1:44.004 aoe o arcane_explosion Fluffy_Pillow 24590.8/63371: 39% mana arcane_charge(3)
1:45.310 aoe p arcane_barrage Fluffy_Pillow 21246.0/63371: 34% mana arcane_charge(4)
1:46.618 aoe o arcane_explosion Fluffy_Pillow 25438.7/63371: 40% mana
1:47.926 aoe o arcane_explosion Fluffy_Pillow 22096.5/63371: 35% mana arcane_charge
1:49.233 aoe o arcane_explosion Fluffy_Pillow 18753.0/63371: 30% mana arcane_charge(2), clearcasting
1:50.539 aoe o arcane_explosion Fluffy_Pillow 20408.3/63371: 32% mana arcane_charge(3)
1:51.845 aoe p arcane_barrage Fluffy_Pillow 17063.6/63371: 27% mana arcane_charge(4)
1:53.151 aoe k touch_of_the_magi Fluffy_Pillow 21253.7/63371: 34% mana
1:54.457 aoe m rune_of_power Fluffy_Pillow 20408.9/63371: 32% mana arcane_charge(4)
1:55.764 aoe p arcane_barrage Fluffy_Pillow 22065.5/63371: 35% mana arcane_charge(4), rune_of_power
1:57.070 aoe o arcane_explosion Fluffy_Pillow 26255.6/63371: 41% mana rune_of_power
1:58.375 aoe o arcane_explosion Fluffy_Pillow 22909.6/63371: 36% mana arcane_charge, rune_of_power
1:59.681 aoe o arcane_explosion Fluffy_Pillow 19564.8/63371: 31% mana arcane_charge(2), rune_of_power
2:00.988 aoe o arcane_explosion Fluffy_Pillow 16221.4/63371: 26% mana arcane_charge(3), rune_of_power
2:02.295 aoe p arcane_barrage Fluffy_Pillow 12877.9/63371: 20% mana arcane_charge(4), clearcasting, rune_of_power
2:03.601 aoe n arcane_orb Fluffy_Pillow 17068.0/63371: 27% mana clearcasting, rune_of_power
2:04.908 aoe p arcane_barrage Fluffy_Pillow 18224.5/63371: 29% mana arcane_charge(4), clearcasting, rune_of_power
2:06.215 aoe o arcane_explosion Fluffy_Pillow 22415.9/63371: 35% mana clearcasting, rune_of_power
2:07.521 aoe o arcane_explosion Fluffy_Pillow 24071.2/63371: 38% mana arcane_charge, rune_of_power
2:08.828 aoe o arcane_explosion Fluffy_Pillow 20727.7/63371: 33% mana arcane_charge(2), clearcasting, rune_of_power
2:10.135 aoe o arcane_explosion Fluffy_Pillow 22384.2/63371: 35% mana arcane_charge(3), rune_of_power
2:11.442 aoe l arcane_power Fluffy_Pillow 19040.8/63371: 30% mana arcane_charge(4)
2:11.442 aoe p arcane_barrage Fluffy_Pillow 19040.8/63371: 30% mana arcane_charge(4), arcane_power, rune_of_power
2:12.748 aoe o arcane_explosion Fluffy_Pillow 23230.9/63371: 37% mana arcane_power, rune_of_power
2:14.054 aoe o arcane_explosion Fluffy_Pillow 22386.2/63371: 35% mana arcane_charge, arcane_power, rune_of_power
2:15.361 aoe o arcane_explosion Fluffy_Pillow 21542.7/63371: 34% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power
2:16.668 aoe o arcane_explosion Fluffy_Pillow 23199.2/63371: 37% mana arcane_charge(3), arcane_power, rune_of_power
2:17.974 aoe p arcane_barrage Fluffy_Pillow 22354.5/63371: 35% mana arcane_charge(4), arcane_power, rune_of_power
2:19.281 aoe o arcane_explosion Fluffy_Pillow 26545.9/63371: 42% mana arcane_power, rune_of_power
2:20.587 aoe o arcane_explosion Fluffy_Pillow 25701.1/63371: 41% mana arcane_charge, arcane_power, rune_of_power
2:21.894 aoe o arcane_explosion Fluffy_Pillow 24857.7/63371: 39% mana arcane_charge(2), arcane_power, rune_of_power
2:23.200 shared_cds r use_mana_gem Venthyr_Theotar 24012.9/63371: 38% mana arcane_charge(3), arcane_power, rune_of_power
2:23.200 aoe o arcane_explosion Fluffy_Pillow 30350.1/63371: 48% mana arcane_charge(3), arcane_power, rune_of_power
2:24.506 aoe p arcane_barrage Fluffy_Pillow 29505.3/63371: 47% mana arcane_charge(4), arcane_power, rune_of_power
2:25.811 aoe n arcane_orb Fluffy_Pillow 33694.2/63371: 53% mana arcane_power, rune_of_power
2:27.118 aoe p arcane_barrage Fluffy_Pillow 35100.7/63371: 55% mana arcane_charge(4)
2:28.424 aoe o arcane_explosion Fluffy_Pillow 39290.8/63371: 62% mana
2:29.731 aoe o arcane_explosion Fluffy_Pillow 35947.4/63371: 57% mana arcane_charge
2:31.037 aoe o arcane_explosion Fluffy_Pillow 32602.6/63371: 51% mana arcane_charge(2)
2:32.343 aoe o arcane_explosion Fluffy_Pillow 29257.9/63371: 46% mana arcane_charge(3)
2:33.650 aoe p arcane_barrage Fluffy_Pillow 25914.4/63371: 41% mana arcane_charge(4), clearcasting
2:34.959 aoe o arcane_explosion Fluffy_Pillow 30108.3/63371: 48% mana clearcasting
2:36.265 aoe o arcane_explosion Fluffy_Pillow 31763.6/63371: 50% mana arcane_charge
2:37.572 aoe o arcane_explosion Fluffy_Pillow 28420.1/63371: 45% mana arcane_charge(2)
2:38.877 aoe o arcane_explosion Fluffy_Pillow 25074.1/63371: 40% mana arcane_charge(3)
2:40.184 aoe p arcane_barrage Fluffy_Pillow 21730.6/63371: 34% mana arcane_charge(4)
2:41.491 aoe j mirrors_of_torment Fluffy_Pillow 25922.0/63371: 41% mana
2:42.796 aoe k touch_of_the_magi Fluffy_Pillow 25576.0/63371: 40% mana
2:44.105 aoe m rune_of_power Fluffy_Pillow 24735.1/63371: 39% mana arcane_charge(4)
2:45.413 aoe p arcane_barrage Fluffy_Pillow 28927.7/63371: 46% mana arcane_charge(4), rune_of_power
2:46.719 aoe n arcane_orb Fluffy_Pillow 33117.9/63371: 52% mana rune_of_power
2:48.026 aoe p arcane_barrage Fluffy_Pillow 34274.4/63371: 54% mana arcane_charge(4), rune_of_power
2:49.332 aoe o arcane_explosion Fluffy_Pillow 38464.5/63371: 61% mana rune_of_power
2:50.638 aoe o arcane_explosion Fluffy_Pillow 37654.6/63371: 59% mana arcane_charge, rune_of_power
2:51.943 aoe o arcane_explosion Fluffy_Pillow 34308.6/63371: 54% mana arcane_charge(2), rune_of_power
2:53.251 aoe o arcane_explosion Fluffy_Pillow 30966.4/63371: 49% mana arcane_charge(3), rune_of_power
2:54.557 aoe p arcane_barrage Fluffy_Pillow 27621.7/63371: 44% mana arcane_charge(4), rune_of_power
2:55.865 aoe o arcane_explosion Fluffy_Pillow 31814.3/63371: 50% mana rune_of_power
2:57.171 aoe o arcane_explosion Fluffy_Pillow 31004.4/63371: 49% mana arcane_charge, rune_of_power
2:58.477 aoe o arcane_explosion Fluffy_Pillow 27659.7/63371: 44% mana arcane_charge(2), rune_of_power
2:59.784 aoe o arcane_explosion Fluffy_Pillow 24316.2/63371: 38% mana arcane_charge(3), rune_of_power
3:01.090 aoe p arcane_barrage Fluffy_Pillow 20971.5/63371: 33% mana arcane_charge(4)
3:02.396 aoe o arcane_explosion Fluffy_Pillow 25161.6/63371: 40% mana
3:03.702 aoe o arcane_explosion Fluffy_Pillow 21816.9/63371: 34% mana arcane_charge
3:05.009 aoe o arcane_explosion Fluffy_Pillow 18473.4/63371: 29% mana arcane_charge(2)
3:06.315 aoe o arcane_explosion Fluffy_Pillow 15128.7/63371: 24% mana arcane_charge(3)
3:07.622 aoe p arcane_barrage Fluffy_Pillow 11785.2/63371: 19% mana arcane_charge(4)
3:08.930 aoe n arcane_orb Fluffy_Pillow 15977.9/63371: 25% mana
3:10.237 aoe p arcane_barrage Fluffy_Pillow 17134.4/63371: 27% mana arcane_charge(4)
3:11.544 aoe o arcane_explosion Fluffy_Pillow 21325.8/63371: 34% mana
3:12.852 aoe o arcane_explosion Fluffy_Pillow 17983.6/63371: 28% mana arcane_charge
3:14.157 aoe o arcane_explosion Fluffy_Pillow 14637.6/63371: 23% mana arcane_charge(2)
3:15.465 aoe o arcane_explosion Fluffy_Pillow 11295.4/63371: 18% mana arcane_charge(3)
3:16.773 aoe p arcane_barrage Fluffy_Pillow 7953.2/63371: 13% mana arcane_charge(4)
3:18.081 aoe o arcane_explosion Fluffy_Pillow 12145.8/63371: 19% mana
3:19.388 aoe o arcane_explosion Fluffy_Pillow 8802.3/63371: 14% mana arcane_charge
3:20.694 aoe o arcane_explosion Fluffy_Pillow 5457.6/63371: 9% mana arcane_charge(2)
3:22.001 aoe q evocation Venthyr_Theotar 2114.1/63371: 3% mana arcane_charge(3)
3:26.346 aoe o arcane_explosion Fluffy_Pillow 55960.1/63371: 88% mana arcane_charge(3)
3:27.653 aoe p arcane_barrage Fluffy_Pillow 52616.6/63371: 83% mana arcane_charge(4), clearcasting
3:28.959 aoe n arcane_orb Fluffy_Pillow 56806.7/63371: 90% mana clearcasting
3:30.265 aoe p arcane_barrage Fluffy_Pillow 57962.0/63371: 91% mana arcane_charge(4), clearcasting
3:31.572 aoe k touch_of_the_magi Fluffy_Pillow 62153.4/63371: 98% mana clearcasting
3:32.878 aoe m rune_of_power Fluffy_Pillow 69522.2/72371: 96% mana arcane_charge(4), clearcasting, soothing_shade
3:34.184 aoe p arcane_barrage Fluffy_Pillow 71412.5/72371: 99% mana arcane_charge(4), clearcasting, rune_of_power, soothing_shade
3:35.489 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana clearcasting, rune_of_power, soothing_shade
3:36.796 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana arcane_charge, rune_of_power, soothing_shade
3:38.102 aoe o arcane_explosion Fluffy_Pillow 69261.8/72371: 96% mana arcane_charge(2), clearcasting, rune_of_power, soothing_shade
3:39.409 aoe o arcane_explosion Fluffy_Pillow 71153.6/72371: 98% mana arcane_charge(3), rune_of_power, soothing_shade
3:40.717 aoe p arcane_barrage Fluffy_Pillow 68046.8/72371: 94% mana arcane_charge(4), rune_of_power, soothing_shade
3:42.025 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana rune_of_power, soothing_shade
3:43.332 aoe o arcane_explosion Fluffy_Pillow 69263.2/72371: 96% mana arcane_charge, clearcasting, rune_of_power, soothing_shade
3:44.639 aoe o arcane_explosion Fluffy_Pillow 71155.0/72371: 98% mana arcane_charge(2), rune_of_power, soothing_shade
3:45.946 aoe o arcane_explosion Fluffy_Pillow 59584.6/63371: 94% mana arcane_charge(3), rune_of_power
3:47.254 aoe p arcane_barrage Fluffy_Pillow 56242.4/63371: 89% mana arcane_charge(4), rune_of_power
3:48.560 aoe o arcane_explosion Fluffy_Pillow 60432.5/63371: 95% mana rune_of_power
3:49.868 aoe o arcane_explosion Fluffy_Pillow 57090.3/63371: 90% mana arcane_charge
3:51.175 aoe o arcane_explosion Fluffy_Pillow 53746.8/63371: 85% mana arcane_charge(2)
3:52.482 aoe o arcane_explosion Fluffy_Pillow 50403.4/63371: 80% mana arcane_charge(3)
3:53.789 aoe p arcane_barrage Fluffy_Pillow 47059.9/63371: 74% mana arcane_charge(4)
3:55.096 aoe n arcane_orb Fluffy_Pillow 51251.3/63371: 81% mana
3:56.403 aoe p arcane_barrage Fluffy_Pillow 52407.8/63371: 83% mana arcane_charge(4)
3:57.708 aoe o arcane_explosion Fluffy_Pillow 56596.7/63371: 89% mana
3:59.012 aoe o arcane_explosion Fluffy_Pillow 53249.4/63371: 84% mana arcane_charge, clearcasting
4:00.317 aoe o arcane_explosion Fluffy_Pillow 54903.4/63371: 87% mana arcane_charge(2)
4:01.624 aoe o arcane_explosion Fluffy_Pillow 51559.9/63371: 81% mana arcane_charge(3)
4:02.933 aoe p arcane_barrage Fluffy_Pillow 48219.0/63371: 76% mana arcane_charge(4), clearcasting
4:04.241 aoe o arcane_explosion Fluffy_Pillow 52411.6/63371: 83% mana clearcasting
4:05.547 aoe o arcane_explosion Fluffy_Pillow 54066.9/63371: 85% mana arcane_charge
4:06.854 aoe o arcane_explosion Fluffy_Pillow 50723.4/63371: 80% mana arcane_charge(2)
4:08.161 aoe o arcane_explosion Fluffy_Pillow 54108.8/72371: 75% mana arcane_charge(3), clearcasting, soothing_shade
4:09.468 aoe p arcane_barrage Fluffy_Pillow 56000.6/72371: 77% mana arcane_charge(4), soothing_shade
4:10.774 aoe o arcane_explosion Fluffy_Pillow 60785.8/72371: 84% mana soothing_shade
4:12.080 aoe o arcane_explosion Fluffy_Pillow 57676.2/72371: 80% mana arcane_charge, soothing_shade
4:13.385 aoe o arcane_explosion Fluffy_Pillow 54565.1/72371: 75% mana arcane_charge(2), soothing_shade
4:14.691 aoe o arcane_explosion Fluffy_Pillow 51455.4/72371: 71% mana arcane_charge(3), soothing_shade
4:15.996 aoe p arcane_barrage Fluffy_Pillow 48344.3/72371: 67% mana arcane_charge(4), soothing_shade
4:17.301 aoe n arcane_orb Fluffy_Pillow 53128.1/72371: 73% mana soothing_shade
4:18.607 aoe p arcane_barrage Fluffy_Pillow 54518.4/72371: 75% mana arcane_charge(4), soothing_shade
4:19.913 aoe j mirrors_of_torment Fluffy_Pillow 51928.7/63371: 82% mana
4:21.221 aoe k touch_of_the_magi Fluffy_Pillow 51586.5/63371: 81% mana clearcasting
4:22.528 aoe l arcane_power Fluffy_Pillow 50743.0/63371: 80% mana arcane_charge(4), clearcasting
4:22.528 shared_cds t berserking Fluffy_Pillow 50743.0/63371: 80% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:22.528 aoe p arcane_barrage Fluffy_Pillow 50743.0/63371: 80% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:23.716 aoe o arcane_explosion Fluffy_Pillow 57318.4/63371: 90% mana berserking, arcane_power, clearcasting(2), rune_of_power
4:24.904 aoe o arcane_explosion Fluffy_Pillow 58824.1/63371: 93% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power
4:26.093 aoe o arcane_explosion Fluffy_Pillow 60331.1/63371: 95% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:27.282 aoe o arcane_explosion Fluffy_Pillow 59338.1/63371: 94% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:28.470 aoe p arcane_barrage Fluffy_Pillow 58343.8/63371: 92% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:29.656 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power
4:30.845 aoe o arcane_explosion Fluffy_Pillow 62378.4/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power
4:32.033 aoe o arcane_explosion Fluffy_Pillow 61384.1/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:33.223 aoe o arcane_explosion Fluffy_Pillow 60392.3/63371: 95% mana berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power
4:34.411 aoe p arcane_barrage Fluffy_Pillow 61898.1/63371: 98% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:35.599 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_power, rune_of_power
4:36.906 aoe o arcane_explosion Fluffy_Pillow 62528.0/63371: 99% mana arcane_charge, arcane_power, rune_of_power
4:38.212 aoe o arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(2)
4:39.518 aoe o arcane_explosion Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(3)
4:40.825 aoe m rune_of_power Fluffy_Pillow 54995.0/63371: 87% mana arcane_charge(4)
4:42.133 aoe p arcane_barrage Fluffy_Pillow 56652.8/63371: 89% mana arcane_charge(4), rune_of_power
4:43.438 aoe n arcane_orb Fluffy_Pillow 60841.7/63371: 96% mana rune_of_power
4:44.745 aoe p arcane_barrage Fluffy_Pillow 61998.2/63371: 98% mana arcane_charge(4), rune_of_power
4:46.051 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
4:47.358 aoe o arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, rune_of_power
4:48.666 aoe o arcane_explosion Fluffy_Pillow 56685.8/63371: 89% mana arcane_charge(2), rune_of_power
4:49.970 shared_cds r use_mana_gem Venthyr_Theotar 53338.5/63371: 84% mana arcane_charge(3), rune_of_power
4:49.970 aoe o arcane_explosion Fluffy_Pillow 59675.6/63371: 94% mana arcane_charge(3), rune_of_power
4:51.277 aoe p arcane_barrage Fluffy_Pillow 56332.2/63371: 89% mana arcane_charge(4), rune_of_power
4:52.585 aoe o arcane_explosion Fluffy_Pillow 60524.8/63371: 96% mana rune_of_power
4:53.890 aoe o arcane_explosion Fluffy_Pillow 57178.8/63371: 90% mana arcane_charge, rune_of_power
4:55.196 aoe o arcane_explosion Fluffy_Pillow 53834.1/63371: 85% mana arcane_charge(2), clearcasting, rune_of_power
4:56.503 aoe o arcane_explosion Fluffy_Pillow 55490.6/63371: 88% mana arcane_charge(3), rune_of_power
4:57.810 aoe p arcane_barrage Fluffy_Pillow 59553.0/72371: 82% mana arcane_charge(4), soothing_shade
4:59.117 aoe o arcane_explosion Fluffy_Pillow 64339.7/72371: 89% mana soothing_shade
5:00.425 aoe o arcane_explosion Fluffy_Pillow 61232.9/72371: 85% mana arcane_charge, soothing_shade
5:01.731 aoe o arcane_explosion Fluffy_Pillow 58123.3/72371: 80% mana arcane_charge(2), soothing_shade
5:03.039 aoe o arcane_explosion Fluffy_Pillow 55016.5/72371: 76% mana arcane_charge(3), clearcasting, soothing_shade
5:04.344 aoe p arcane_barrage Fluffy_Pillow 56905.4/72371: 79% mana arcane_charge(4), soothing_shade
5:05.651 aoe n arcane_orb Fluffy_Pillow 61692.0/72371: 85% mana soothing_shade
5:06.957 aoe p arcane_barrage Fluffy_Pillow 63082.4/72371: 87% mana arcane_charge(4), soothing_shade
5:08.264 aoe o arcane_explosion Fluffy_Pillow 67869.0/72371: 94% mana soothing_shade
5:09.571 aoe o arcane_explosion Fluffy_Pillow 56707.3/63371: 89% mana arcane_charge
5:10.879 aoe o arcane_explosion Fluffy_Pillow 53365.1/63371: 84% mana arcane_charge(2)
5:12.186 aoe o arcane_explosion Fluffy_Pillow 50021.6/63371: 79% mana arcane_charge(3)
5:13.493 aoe p arcane_barrage Fluffy_Pillow 46678.1/63371: 74% mana arcane_charge(4), clearcasting
5:14.800 aoe o arcane_explosion Fluffy_Pillow 50869.5/63371: 80% mana clearcasting
5:16.105 aoe o arcane_explosion Fluffy_Pillow 52523.5/63371: 83% mana arcane_charge
5:17.411 aoe o arcane_explosion Fluffy_Pillow 49178.8/63371: 78% mana arcane_charge(2)
5:18.718 aoe o arcane_explosion Fluffy_Pillow 45835.3/63371: 72% mana arcane_charge(3), clearcasting
5:20.024 aoe p arcane_barrage Fluffy_Pillow 47490.6/63371: 75% mana arcane_charge(4)
5:21.330 aoe o arcane_explosion Fluffy_Pillow 51680.7/63371: 82% mana
5:22.634 aoe o arcane_explosion Fluffy_Pillow 48333.4/63371: 76% mana arcane_charge
5:23.941 aoe o arcane_explosion Fluffy_Pillow 44989.9/63371: 71% mana arcane_charge(2)
5:25.246 aoe o arcane_explosion Fluffy_Pillow 41643.9/63371: 66% mana arcane_charge(3), clearcasting
5:26.552 aoe p arcane_barrage Fluffy_Pillow 43299.2/63371: 68% mana arcane_charge(4)
5:27.857 aoe k touch_of_the_magi Fluffy_Pillow 47488.0/63371: 75% mana

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Theotar"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=336239//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

arcane : 10454 dps, 4442 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10453.9 10453.9 16.5 / 0.158% 1102.8 / 10.5% 5.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
2052.5 1948.8 Mana 0.00% 49.4 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcane 10454
Arcane Barrage 4018 38.5% 57.4 5.25sec 21084 16965 Direct 171.9 5908 11790 7038 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.36 171.86 0.00 0.00 1.2427 0.0000 1209429.99 1209429.99 0.00% 16965.41 16965.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 138.83 101 179 5907.79 2082 25140 5895.97 5237 6576 819791 819791 0.00%
crit 19.22% 33.03 16 55 11789.75 4164 50280 11777.53 7560 16173 389639 389639 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:57.36
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [q]:0.00
Arcane Echo 234 2.2% 36.8 7.63sec 1904 0 Direct 110.4 532 1062 635 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.81 110.43 0.00 0.00 0.0000 0.0000 70094.33 70094.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 88.99 58 119 532.03 443 664 531.50 495 560 47339 47339 0.00%
crit 19.41% 21.44 7 36 1061.63 886 1329 1060.83 920 1236 22756 22756 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4740 45.3% 155.2 1.91sec 9179 7386 Direct 465.6 2565 5136 3060 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.21 465.63 0.00 0.00 1.2428 0.0000 1424747.50 1424747.50 0.00% 7386.21 7386.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 375.96 285 469 2565.36 1958 4112 2565.58 2473 2668 964326 964326 0.00%
crit 19.26% 89.67 53 134 5135.54 3916 8223 5135.37 4647 5648 460421 460421 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:155.22
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (849) 0.0% (8.1%) 13.1 23.65sec 19420 15573

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.14 0.00 0.00 0.00 1.2471 0.0000 0.00 0.00 0.00% 15573.21 15573.21

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.14
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 849 8.1% 39.3 23.65sec 6485 0 Direct 39.3 5461 10904 6487 18.8%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.35 39.35 0.00 0.00 0.0000 0.0000 255151.48 255151.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.16% 31.93 20 43 5461.29 3869 8126 5461.19 4837 5976 174352 174352 0.00%
crit 18.84% 7.41 0 19 10904.26 7739 16251 10885.71 0 16251 80799 80799 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.6%) 14.5 1.79sec 1390 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.6% 14.5 1.79sec 1390 0 Direct 14.5 1164 2327 1389 19.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.49 14.49 0.00 0.00 0.0000 0.0000 20134.60 20134.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 11.67 5 19 1163.53 1164 1164 1163.53 1164 1164 13584 13584 0.00%
crit 19.43% 2.82 0 9 2327.06 2327 2327 2221.00 0 2327 6551 6551 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1781 20.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1778.40 1778.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.89% 0.80 0 1 1480.68 1481 1481 1182.95 0 1481 1183 1183 0.00%
crit 20.11% 0.20 0 1 2961.35 2961 2961 595.45 0 2961 595 595 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6051 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 113 67 19.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6051.09 6051.09 0.00% 51.38 51.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.44% 72.40 59 83 56.21 43 60 56.21 55 58 4069 4069 0.00%
crit 19.56% 17.60 7 31 112.58 86 120 112.66 102 120 1982 1982 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (519) 0.0% (5.0%) 6.1 52.22sec 25409 19448

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 19448.16 19448.16

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.16
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 519 5.0% 6.1 52.13sec 25409 0 Direct 18.4 8490 0 8490 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 18.37 0.00 0.00 0.0000 0.0000 155857.55 155857.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.37 15 21 8490.20 2035 36003 8477.89 6046 11486 155858 155858 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8170.01
  • base_dd_max:8170.01
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
arcane
Arcane Power 2.8 128.38sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.85
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 256.69sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.85
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 169.28sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.21 0.00 7.18 0.00 4.3139 0.7223 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.20
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.9 51.14sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 0.00 0.00 0.00 1.2560 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:5.97
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.68sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.76
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.1 155.7 5.2sec 1.4sec 3.8sec 74.01% 0.00% 0.8 (0.9) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.3s
  • trigger_min/max:0.0s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:19.09%
  • arcane_charge_2:16.45%
  • arcane_charge_3:16.90%
  • arcane_charge_4:21.57%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.4sec 128.4sec 14.7sec 13.94% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.8s / 136.7s
  • trigger_min/max:120.8s / 136.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:13.94%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 256.6sec 256.6sec 11.7sec 7.15% 23.75% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.9s / 265.7s
  • trigger_min/max:253.9s / 265.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • berserking_1:7.15%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.4 0.1 11.9sec 11.9sec 1.9sec 15.69% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.57%
  • clearcasting_2:0.13%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.2 0.0 166.9sec 166.9sec 4.3sec 1.73% 0.00% 4.8 (4.8) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:101.0s / 284.4s
  • trigger_min/max:101.0s / 284.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:1.73%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.42% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.42%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.6sec 35.6sec 14.7sec 42.94% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 52.7s
  • trigger_min/max:15.7s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.94%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.79%
Arcane Barrage Arcane Charge 4 100.00% 98.21% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.04% 0.76% 6.63% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.737120.053239.903
Evocation137.28611.017333.966209.426113.726343.826
Rune of Power6.8700.00927.31943.25524.00658.578
Touch of the Magi5.1080.00027.58633.88822.39956.972
Arcane Power5.9070.76316.72017.0859.22026.989
Arcane Barrage2.7480.0008.279158.752126.313191.949
Arcane Orb3.5300.01210.48446.70633.73561.175

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
arcane
mana_regen Mana 491.29 371052.05 63.32% 755.26 9428.04 2.48%
Evocation Mana 57.50 57811.15 9.87% 1005.33 0.00 0.00%
Mana Gem Mana 2.76 17470.41 2.98% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.36 139676.40 23.84% 2435.14 5718.87 3.93%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1948.79 2052.45 15140.2 32196.0 204.1 63371.4
Usage Type Count Total Avg RPE APR
arcane
arcane_explosion Mana 155.2 595063.9 3833.7 3833.9 2.4
arcane_orb Mana 13.1 5863.0 446.3 446.2 43.5
touch_of_the_magi Mana 6.1 15330.4 2500.0 2499.2 10.2

Statistics & Data Analysis

Fight Length
arcane Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
arcane Damage Per Second
Count 1119
Mean 10453.85
Minimum 9658.04
Maximum 11374.25
Spread ( max - min ) 1716.22
Range [ ( max - min ) / 2 * 100% ] 8.21%
Standard Deviation 281.9354
5th Percentile 9992.08
95th Percentile 10920.44
( 95th Percentile - 5th Percentile ) 928.37
Mean Distribution
Standard Deviation 8.4282
95.00% Confidence Interval ( 10437.33 - 10470.37 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2795
0.1 Scale Factor Error with Delta=300 679
0.05 Scale Factor Error with Delta=300 2715
0.01 Scale Factor Error with Delta=300 67856
Priority Target DPS
arcane Priority Target Damage Per Second
Count 1119
Mean 4441.56
Minimum 3955.86
Maximum 5001.86
Spread ( max - min ) 1046.00
Range [ ( max - min ) / 2 * 100% ] 11.78%
Standard Deviation 166.3686
5th Percentile 4154.77
95th Percentile 4725.27
( 95th Percentile - 5th Percentile ) 570.50
Mean Distribution
Standard Deviation 4.9734
95.00% Confidence Interval ( 4431.81 - 4451.31 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5390
0.1 Scale Factor Error with Delta=300 237
0.05 Scale Factor Error with Delta=300 946
0.01 Scale Factor Error with Delta=300 23628
DPS(e)
arcane Damage Per Second (Effective)
Count 1119
Mean 10453.85
Minimum 9658.04
Maximum 11374.25
Spread ( max - min ) 1716.22
Range [ ( max - min ) / 2 * 100% ] 8.21%
Damage
arcane Damage
Count 1119
Mean 3137193.86
Minimum 2399704.70
Maximum 3836189.88
Spread ( max - min ) 1436485.18
Range [ ( max - min ) / 2 * 100% ] 22.89%
DTPS
arcane Damage Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
arcane Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
arcane Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
arcane Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
arcane Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
arcane Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
arcaneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
arcane Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.16 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.85 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 5.97 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.14 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 155.22 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 57.36 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.20 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.76 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.85 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkstomonnnnonnnnonnnnlonnnnromonnnnonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnkonnnnonnnnromonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonpnnnomonnnnojktonnnnornnnnomonnnnlonnnnonnnnomonnnnonnnnonnnnomonnnnojlon

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask arcane 63371.4/63371: 100% mana
Pre precombat R food arcane 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), clearcasting
0:01.306 shared_cds s potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power
0:01.306 shared_cds t berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:01.306 aoe o arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:02.220 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:03.135 aoe o arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.049 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.962 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.877 aoe n arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.790 aoe n arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.705 aoe o arcane_barrage Fluffy_Pillow 59348.0/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.621 aoe n arcane_explosion Fluffy_Pillow 63043.8/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.534 aoe n arcane_explosion Fluffy_Pillow 61701.0/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.448 aoe n arcane_explosion Fluffy_Pillow 60359.4/63371: 95% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.364 aoe n arcane_explosion Fluffy_Pillow 59020.4/63371: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.281 aoe o arcane_barrage Fluffy_Pillow 57682.6/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.195 aoe n arcane_explosion Fluffy_Pillow 61375.9/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.110 aoe n arcane_explosion Fluffy_Pillow 60035.6/63371: 95% mana bloodlust, arcane_charge, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:15.117 aoe n arcane_explosion Fluffy_Pillow 61311.9/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.123 aoe n arcane_explosion Fluffy_Pillow 60086.9/63371: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.129 aoe l rune_of_power Fluffy_Pillow 58861.9/63371: 93% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.136 aoe o arcane_barrage Fluffy_Pillow 60138.2/63371: 95% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.142 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.150 aoe n arcane_explosion Fluffy_Pillow 59649.0/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
0:21.156 aoe n arcane_explosion Fluffy_Pillow 60924.0/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.164 aoe n arcane_explosion Fluffy_Pillow 57201.6/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.170 shared_cds r use_mana_gem arcane 53476.6/63371: 84% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:23.170 aoe o arcane_barrage Fluffy_Pillow 59813.8/63371: 94% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:24.176 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:25.182 aoe o arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:26.191 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.197 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power
0:28.205 aoe n arcane_explosion Fluffy_Pillow 59649.0/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power
0:29.210 aoe n arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power
0:30.216 aoe o arcane_barrage Fluffy_Pillow 52197.8/63371: 82% mana bloodlust, arcane_charge(4), rune_of_power
0:31.223 aoe n arcane_explosion Fluffy_Pillow 56009.0/63371: 88% mana bloodlust, rune_of_power
0:32.230 aoe n arcane_explosion Fluffy_Pillow 52285.3/63371: 83% mana bloodlust, arcane_charge, rune_of_power
0:33.236 aoe n arcane_explosion Fluffy_Pillow 48560.3/63371: 77% mana bloodlust, arcane_charge(2), clearcasting
0:34.242 aoe n arcane_explosion Fluffy_Pillow 49835.3/63371: 79% mana bloodlust, arcane_charge(3)
0:35.248 aoe o arcane_barrage Fluffy_Pillow 46110.4/63371: 73% mana bloodlust, arcane_charge(4)
0:36.253 aoe n arcane_explosion Fluffy_Pillow 49919.0/63371: 79% mana bloodlust
0:37.260 aoe n arcane_explosion Fluffy_Pillow 46195.3/63371: 73% mana bloodlust, arcane_charge, clearcasting
0:38.269 aoe n arcane_explosion Fluffy_Pillow 47474.1/63371: 75% mana bloodlust, arcane_charge(2)
0:39.275 aoe n arcane_explosion Fluffy_Pillow 43749.1/63371: 69% mana bloodlust, arcane_charge(3)
0:40.279 aoe o arcane_barrage Fluffy_Pillow 40021.6/63371: 63% mana bloodlust, arcane_charge(4), clearcasting
0:41.284 aoe n arcane_explosion Fluffy_Pillow 43830.3/63371: 69% mana clearcasting
0:42.591 aoe n arcane_explosion Fluffy_Pillow 45486.8/63371: 72% mana arcane_charge
0:43.898 aoe n arcane_explosion Fluffy_Pillow 42143.3/63371: 67% mana arcane_charge(2)
0:45.206 aoe n arcane_explosion Fluffy_Pillow 38801.1/63371: 61% mana arcane_charge(3)
0:46.513 aoe o arcane_barrage Fluffy_Pillow 35457.7/63371: 56% mana arcane_charge(4), clearcasting
0:47.819 aoe m arcane_orb Fluffy_Pillow 39647.8/63371: 63% mana clearcasting
0:49.125 aoe o arcane_barrage Fluffy_Pillow 40803.0/63371: 64% mana arcane_charge(4), clearcasting
0:50.433 aoe n arcane_explosion Fluffy_Pillow 44995.7/63371: 71% mana clearcasting
0:51.739 aoe n arcane_explosion Fluffy_Pillow 46650.9/63371: 74% mana arcane_charge
0:53.046 aoe n arcane_explosion Fluffy_Pillow 43307.5/63371: 68% mana arcane_charge(2)
0:54.352 aoe n arcane_explosion Fluffy_Pillow 39962.7/63371: 63% mana arcane_charge(3), clearcasting
0:55.660 aoe o arcane_barrage Fluffy_Pillow 41620.5/63371: 66% mana arcane_charge(4)
0:56.968 aoe n arcane_explosion Fluffy_Pillow 45813.2/63371: 72% mana
0:58.274 aoe n arcane_explosion Fluffy_Pillow 42468.4/63371: 67% mana arcane_charge, clearcasting
0:59.579 aoe n arcane_explosion Fluffy_Pillow 44122.4/63371: 70% mana arcane_charge(2)
1:00.884 aoe n arcane_explosion Fluffy_Pillow 40776.4/63371: 64% mana arcane_charge(3)
1:02.190 aoe o arcane_barrage Fluffy_Pillow 37431.7/63371: 59% mana arcane_charge(4)
1:03.496 aoe j touch_of_the_magi Fluffy_Pillow 41621.8/63371: 66% mana
1:04.802 aoe l rune_of_power Fluffy_Pillow 40777.1/63371: 64% mana arcane_charge(4), clearcasting
1:06.108 aoe o arcane_barrage Fluffy_Pillow 42432.3/63371: 67% mana arcane_charge(4), clearcasting, rune_of_power
1:07.413 aoe n arcane_explosion Fluffy_Pillow 46621.2/63371: 74% mana clearcasting, rune_of_power
1:08.720 aoe n arcane_explosion Fluffy_Pillow 48277.7/63371: 76% mana arcane_charge, rune_of_power
1:10.026 aoe n arcane_explosion Fluffy_Pillow 44933.0/63371: 71% mana arcane_charge(2), clearcasting, rune_of_power
1:11.333 aoe n arcane_explosion Fluffy_Pillow 46589.5/63371: 74% mana arcane_charge(3), rune_of_power
1:12.641 aoe o arcane_barrage Fluffy_Pillow 43247.3/63371: 68% mana arcane_charge(4), rune_of_power
1:13.946 aoe m arcane_orb Fluffy_Pillow 47436.2/63371: 75% mana rune_of_power
1:15.254 aoe o arcane_barrage Fluffy_Pillow 48594.0/63371: 77% mana arcane_charge(4), rune_of_power
1:16.562 aoe n arcane_explosion Fluffy_Pillow 52786.6/63371: 83% mana rune_of_power
1:17.866 aoe n arcane_explosion Fluffy_Pillow 49439.3/63371: 78% mana arcane_charge, rune_of_power
1:19.171 aoe n arcane_explosion Fluffy_Pillow 46093.3/63371: 73% mana arcane_charge(2), rune_of_power
1:20.479 aoe n arcane_explosion Fluffy_Pillow 42751.1/63371: 67% mana arcane_charge(3), rune_of_power
1:21.786 aoe o arcane_barrage Fluffy_Pillow 39407.7/63371: 62% mana arcane_charge(4)
1:23.093 aoe n arcane_explosion Fluffy_Pillow 43599.0/63371: 69% mana
1:24.400 aoe n arcane_explosion Fluffy_Pillow 40255.6/63371: 64% mana arcane_charge
1:25.706 aoe n arcane_explosion Fluffy_Pillow 36910.8/63371: 58% mana arcane_charge(2)
1:27.011 aoe n arcane_explosion Fluffy_Pillow 33564.8/63371: 53% mana arcane_charge(3)
1:28.317 aoe o arcane_barrage Fluffy_Pillow 30220.1/63371: 48% mana arcane_charge(4)
1:29.623 aoe n arcane_explosion Fluffy_Pillow 34410.2/63371: 54% mana
1:30.931 aoe n arcane_explosion Fluffy_Pillow 31068.0/63371: 49% mana arcane_charge
1:32.237 aoe n arcane_explosion Fluffy_Pillow 27723.3/63371: 44% mana arcane_charge(2)
1:33.544 aoe n arcane_explosion Fluffy_Pillow 24379.8/63371: 38% mana arcane_charge(3)
1:34.850 aoe o arcane_barrage Fluffy_Pillow 21035.1/63371: 33% mana arcane_charge(4)
1:36.157 aoe m arcane_orb Fluffy_Pillow 25226.4/63371: 40% mana
1:37.463 aoe o arcane_barrage Fluffy_Pillow 26381.7/63371: 42% mana arcane_charge(4)
1:38.769 aoe n arcane_explosion Fluffy_Pillow 30571.8/63371: 48% mana
1:40.074 aoe n arcane_explosion Fluffy_Pillow 27225.8/63371: 43% mana arcane_charge
1:41.381 aoe n arcane_explosion Fluffy_Pillow 23882.3/63371: 38% mana arcane_charge(2)
1:42.688 aoe n arcane_explosion Fluffy_Pillow 20538.9/63371: 32% mana arcane_charge(3), clearcasting
1:43.995 aoe o arcane_barrage Fluffy_Pillow 22195.4/63371: 35% mana arcane_charge(4)
1:45.301 aoe n arcane_explosion Fluffy_Pillow 26385.5/63371: 42% mana
1:46.607 aoe n arcane_explosion Fluffy_Pillow 23040.8/63371: 36% mana arcane_charge
1:47.913 aoe n arcane_explosion Fluffy_Pillow 19696.1/63371: 31% mana arcane_charge(2), clearcasting
1:49.219 aoe n arcane_explosion Fluffy_Pillow 21351.3/63371: 34% mana arcane_charge(3)
1:50.525 aoe o arcane_barrage Fluffy_Pillow 18006.6/63371: 28% mana arcane_charge(4)
1:51.831 aoe j touch_of_the_magi Fluffy_Pillow 22196.7/63371: 35% mana
1:53.137 aoe l rune_of_power Fluffy_Pillow 21352.0/63371: 34% mana arcane_charge(4), clearcasting
1:54.443 aoe o arcane_barrage Fluffy_Pillow 23007.2/63371: 36% mana arcane_charge(4), clearcasting, rune_of_power
1:55.750 aoe n arcane_explosion Fluffy_Pillow 27198.6/63371: 43% mana clearcasting, rune_of_power
1:57.056 aoe n arcane_explosion Fluffy_Pillow 28853.9/63371: 46% mana arcane_charge, rune_of_power
1:58.362 aoe n arcane_explosion Fluffy_Pillow 25509.1/63371: 40% mana arcane_charge(2), clearcasting, rune_of_power
1:59.668 aoe n arcane_explosion Fluffy_Pillow 27164.4/63371: 43% mana arcane_charge(3), rune_of_power
2:00.974 aoe o arcane_barrage Fluffy_Pillow 23819.6/63371: 38% mana arcane_charge(4), rune_of_power
2:02.278 aoe m arcane_orb Fluffy_Pillow 28007.2/63371: 44% mana rune_of_power
2:03.586 aoe o arcane_barrage Fluffy_Pillow 29165.0/63371: 46% mana arcane_charge(4), rune_of_power
2:04.892 aoe n arcane_explosion Fluffy_Pillow 33355.1/63371: 53% mana rune_of_power
2:06.198 aoe n arcane_explosion Fluffy_Pillow 30010.4/63371: 47% mana arcane_charge, rune_of_power
2:07.506 aoe n arcane_explosion Fluffy_Pillow 26668.2/63371: 42% mana arcane_charge(2), clearcasting, rune_of_power
2:08.813 aoe n arcane_explosion Fluffy_Pillow 28324.7/63371: 45% mana arcane_charge(3), rune_of_power
2:10.120 aoe k arcane_power Fluffy_Pillow 24981.3/63371: 39% mana arcane_charge(4)
2:10.120 aoe o arcane_barrage Fluffy_Pillow 24981.3/63371: 39% mana arcane_charge(4), arcane_power, rune_of_power
2:11.428 aoe n arcane_explosion Fluffy_Pillow 29173.9/63371: 46% mana arcane_power, rune_of_power
2:12.734 aoe n arcane_explosion Fluffy_Pillow 28329.2/63371: 45% mana arcane_charge, arcane_power, rune_of_power
2:14.041 aoe n arcane_explosion Fluffy_Pillow 27485.7/63371: 43% mana arcane_charge(2), arcane_power, rune_of_power
2:15.348 aoe n arcane_explosion Fluffy_Pillow 26642.2/63371: 42% mana arcane_charge(3), arcane_power, rune_of_power
2:16.656 aoe o arcane_barrage Fluffy_Pillow 25800.0/63371: 41% mana arcane_charge(4), arcane_power, rune_of_power
2:17.962 aoe n arcane_explosion Fluffy_Pillow 29990.2/63371: 47% mana arcane_power, rune_of_power
2:19.270 aoe n arcane_explosion Fluffy_Pillow 29148.0/63371: 46% mana arcane_charge, arcane_power, rune_of_power
2:20.576 aoe n arcane_explosion Fluffy_Pillow 28303.2/63371: 45% mana arcane_charge(2), arcane_power, rune_of_power
2:21.882 aoe n arcane_explosion Fluffy_Pillow 27458.5/63371: 43% mana arcane_charge(3), arcane_power, rune_of_power
2:23.191 shared_cds r use_mana_gem arcane 26617.5/63371: 42% mana arcane_charge(4), arcane_power, rune_of_power
2:23.191 aoe o arcane_barrage Fluffy_Pillow 32954.7/63371: 52% mana arcane_charge(4), arcane_power, rune_of_power
2:24.499 aoe m arcane_orb Fluffy_Pillow 37147.3/63371: 59% mana arcane_power, rune_of_power
2:25.804 aoe o arcane_barrage Fluffy_Pillow 38551.3/63371: 61% mana arcane_charge(4)
2:27.109 aoe n arcane_explosion Fluffy_Pillow 42740.2/63371: 67% mana
2:28.414 aoe n arcane_explosion Fluffy_Pillow 39394.2/63371: 62% mana arcane_charge
2:29.721 aoe n arcane_explosion Fluffy_Pillow 36050.7/63371: 57% mana arcane_charge(2)
2:31.027 aoe n arcane_explosion Fluffy_Pillow 32706.0/63371: 52% mana arcane_charge(3)
2:32.335 aoe o arcane_barrage Fluffy_Pillow 29363.8/63371: 46% mana arcane_charge(4)
2:33.642 aoe n arcane_explosion Fluffy_Pillow 33555.1/63371: 53% mana
2:34.950 aoe n arcane_explosion Fluffy_Pillow 30212.9/63371: 48% mana arcane_charge
2:36.256 aoe n arcane_explosion Fluffy_Pillow 26868.2/63371: 42% mana arcane_charge(2)
2:37.561 aoe n arcane_explosion Fluffy_Pillow 23522.2/63371: 37% mana arcane_charge(3)
2:38.869 aoe o arcane_barrage Fluffy_Pillow 20180.0/63371: 32% mana arcane_charge(4), clearcasting
2:40.176 aoe j touch_of_the_magi Fluffy_Pillow 24371.4/63371: 38% mana clearcasting
2:41.484 aoe l rune_of_power Fluffy_Pillow 23529.2/63371: 37% mana arcane_charge(4), clearcasting
2:42.790 aoe o arcane_barrage Fluffy_Pillow 25184.4/63371: 40% mana arcane_charge(4), clearcasting, rune_of_power
2:44.097 aoe n arcane_explosion Fluffy_Pillow 29375.8/63371: 46% mana clearcasting, rune_of_power
2:45.404 aoe n arcane_explosion Fluffy_Pillow 31032.4/63371: 49% mana arcane_charge, rune_of_power
2:46.710 aoe n arcane_explosion Fluffy_Pillow 27687.6/63371: 44% mana arcane_charge(2), rune_of_power
2:48.016 aoe n arcane_explosion Fluffy_Pillow 24342.9/63371: 38% mana arcane_charge(3), rune_of_power
2:49.323 aoe o arcane_barrage Fluffy_Pillow 20999.4/63371: 33% mana arcane_charge(4), rune_of_power
2:50.631 aoe m arcane_orb Fluffy_Pillow 25192.1/63371: 40% mana rune_of_power
2:51.936 aoe o arcane_barrage Fluffy_Pillow 26346.1/63371: 42% mana arcane_charge(4), rune_of_power
2:53.241 aoe n arcane_explosion Fluffy_Pillow 30534.9/63371: 48% mana rune_of_power
2:54.548 aoe n arcane_explosion Fluffy_Pillow 27191.4/63371: 43% mana arcane_charge, clearcasting, rune_of_power
2:55.853 aoe n arcane_explosion Fluffy_Pillow 28845.4/63371: 46% mana arcane_charge(2), rune_of_power
2:57.161 aoe n arcane_explosion Fluffy_Pillow 25503.2/63371: 40% mana arcane_charge(3), clearcasting, rune_of_power
2:58.466 aoe o arcane_barrage Fluffy_Pillow 27157.2/63371: 43% mana arcane_charge(4)
2:59.773 aoe n arcane_explosion Fluffy_Pillow 31348.6/63371: 49% mana
3:01.080 aoe n arcane_explosion Fluffy_Pillow 28005.1/63371: 44% mana arcane_charge
3:02.388 aoe n arcane_explosion Fluffy_Pillow 24662.9/63371: 39% mana arcane_charge(2)
3:03.694 aoe n arcane_explosion Fluffy_Pillow 21318.2/63371: 34% mana arcane_charge(3)
3:05.000 aoe o arcane_barrage Fluffy_Pillow 17973.5/63371: 28% mana arcane_charge(4), clearcasting
3:06.308 aoe n arcane_explosion Fluffy_Pillow 22166.1/63371: 35% mana clearcasting
3:07.614 aoe n arcane_explosion Fluffy_Pillow 23821.4/63371: 38% mana arcane_charge
3:08.920 aoe n arcane_explosion Fluffy_Pillow 20476.6/63371: 32% mana arcane_charge(2)
3:10.227 aoe n arcane_explosion Fluffy_Pillow 17133.2/63371: 27% mana arcane_charge(3)
3:11.533 aoe o arcane_barrage Fluffy_Pillow 13788.4/63371: 22% mana arcane_charge(4), clearcasting
3:12.840 aoe m arcane_orb Fluffy_Pillow 17979.8/63371: 28% mana clearcasting
3:14.148 aoe o arcane_barrage Fluffy_Pillow 19137.6/63371: 30% mana arcane_charge(4), clearcasting
3:15.454 aoe n arcane_explosion Fluffy_Pillow 23327.7/63371: 37% mana clearcasting
3:16.762 aoe n arcane_explosion Fluffy_Pillow 24985.5/63371: 39% mana arcane_charge
3:18.067 aoe n arcane_explosion Fluffy_Pillow 21639.5/63371: 34% mana arcane_charge(2)
3:19.374 aoe n arcane_explosion Fluffy_Pillow 18296.0/63371: 29% mana arcane_charge(3)
3:20.679 aoe o arcane_barrage Fluffy_Pillow 14950.0/63371: 24% mana arcane_charge(4), clearcasting
3:21.986 aoe n arcane_explosion Fluffy_Pillow 19141.4/63371: 30% mana clearcasting
3:23.293 aoe n arcane_explosion Fluffy_Pillow 20798.0/63371: 33% mana arcane_charge
3:24.599 aoe n arcane_explosion Fluffy_Pillow 17453.2/63371: 28% mana arcane_charge(2)
3:25.905 aoe n arcane_explosion Fluffy_Pillow 14108.5/63371: 22% mana arcane_charge(3), clearcasting
3:27.212 aoe o arcane_barrage Fluffy_Pillow 15765.0/63371: 25% mana arcane_charge(4)
3:28.519 aoe j touch_of_the_magi Fluffy_Pillow 19956.4/63371: 31% mana
3:29.826 aoe l rune_of_power Fluffy_Pillow 19112.9/63371: 30% mana arcane_charge(4)
3:31.133 aoe o arcane_barrage Fluffy_Pillow 20769.5/63371: 33% mana arcane_charge(4), rune_of_power
3:32.441 aoe n arcane_explosion Fluffy_Pillow 24962.1/63371: 39% mana rune_of_power
3:33.746 aoe n arcane_explosion Fluffy_Pillow 21616.1/63371: 34% mana arcane_charge, rune_of_power
3:35.052 aoe n arcane_explosion Fluffy_Pillow 18271.4/63371: 29% mana arcane_charge(2), rune_of_power
3:36.359 aoe n arcane_explosion Fluffy_Pillow 14927.9/63371: 24% mana arcane_charge(3), clearcasting, rune_of_power
3:37.668 aoe o arcane_barrage Fluffy_Pillow 16587.0/63371: 26% mana arcane_charge(4), rune_of_power
3:38.973 aoe m arcane_orb Fluffy_Pillow 20775.8/63371: 33% mana rune_of_power
3:40.280 aoe o arcane_barrage Fluffy_Pillow 21932.3/63371: 35% mana arcane_charge(4), rune_of_power
3:41.587 aoe n arcane_explosion Fluffy_Pillow 26123.7/63371: 41% mana rune_of_power
3:42.893 aoe n arcane_explosion Fluffy_Pillow 22779.0/63371: 36% mana arcane_charge, rune_of_power
3:44.200 aoe n arcane_explosion Fluffy_Pillow 19435.5/63371: 31% mana arcane_charge(2), rune_of_power
3:45.506 aoe n arcane_explosion Fluffy_Pillow 16090.8/63371: 25% mana arcane_charge(3), rune_of_power
3:46.814 aoe o arcane_barrage Fluffy_Pillow 12748.6/63371: 20% mana arcane_charge(4)
3:48.121 aoe n arcane_explosion Fluffy_Pillow 16940.0/63371: 27% mana
3:49.425 aoe n arcane_explosion Fluffy_Pillow 13592.7/63371: 21% mana arcane_charge
3:50.731 aoe n arcane_explosion Fluffy_Pillow 10247.9/63371: 16% mana arcane_charge(2)
3:52.036 aoe n arcane_explosion Fluffy_Pillow 6901.9/63371: 11% mana arcane_charge(3)
3:53.341 aoe o arcane_barrage Fluffy_Pillow 3555.9/63371: 6% mana arcane_charge(4)
3:54.648 aoe n arcane_explosion Fluffy_Pillow 7747.3/63371: 12% mana
3:55.953 aoe p evocation arcane 4401.3/63371: 7% mana arcane_charge
4:00.298 aoe n arcane_explosion Fluffy_Pillow 58247.3/63371: 92% mana arcane_charge
4:01.605 aoe n arcane_explosion Fluffy_Pillow 54903.8/63371: 87% mana arcane_charge(2)
4:02.913 aoe n arcane_explosion Fluffy_Pillow 51561.6/63371: 81% mana arcane_charge(3)
4:04.220 aoe o arcane_barrage Fluffy_Pillow 48218.1/63371: 76% mana arcane_charge(4)
4:05.524 aoe m arcane_orb Fluffy_Pillow 52405.7/63371: 83% mana
4:06.830 aoe o arcane_barrage Fluffy_Pillow 53561.0/63371: 85% mana arcane_charge(4)
4:08.136 aoe n arcane_explosion Fluffy_Pillow 57751.1/63371: 91% mana
4:09.442 aoe n arcane_explosion Fluffy_Pillow 54406.3/63371: 86% mana arcane_charge
4:10.749 aoe n arcane_explosion Fluffy_Pillow 51062.9/63371: 81% mana arcane_charge(2)
4:12.055 aoe n arcane_explosion Fluffy_Pillow 47718.1/63371: 75% mana arcane_charge(3)
4:13.362 aoe o arcane_barrage Fluffy_Pillow 44374.7/63371: 70% mana arcane_charge(4)
4:14.667 aoe j touch_of_the_magi Fluffy_Pillow 48563.5/63371: 77% mana
4:16.127 aoe k arcane_power Fluffy_Pillow 47914.0/63371: 76% mana arcane_charge(4)
4:16.127 shared_cds t berserking Fluffy_Pillow 47914.0/63371: 76% mana arcane_charge(4), arcane_power, rune_of_power
4:16.127 aoe o arcane_barrage Fluffy_Pillow 47914.0/63371: 76% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:17.315 aoe n arcane_explosion Fluffy_Pillow 51954.5/63371: 82% mana berserking, arcane_power, rune_of_power
4:18.504 aoe n arcane_explosion Fluffy_Pillow 50961.5/63371: 80% mana berserking, arcane_charge, arcane_power, rune_of_power
4:19.692 aoe n arcane_explosion Fluffy_Pillow 49967.2/63371: 79% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:20.881 aoe n arcane_explosion Fluffy_Pillow 48974.2/63371: 77% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:22.070 aoe o arcane_barrage Fluffy_Pillow 47981.1/63371: 76% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:23.259 shared_cds r use_mana_gem arcane 52023.0/63371: 82% mana berserking, arcane_power, rune_of_power
4:23.259 aoe n arcane_explosion Fluffy_Pillow 58360.1/63371: 92% mana berserking, arcane_power, rune_of_power
4:24.446 aoe n arcane_explosion Fluffy_Pillow 57364.5/63371: 91% mana berserking, arcane_charge, arcane_power, rune_of_power
4:25.635 aoe n arcane_explosion Fluffy_Pillow 56371.5/63371: 89% mana berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power
4:26.823 aoe n arcane_explosion Fluffy_Pillow 57877.2/63371: 91% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:28.012 aoe o arcane_barrage Fluffy_Pillow 56884.2/63371: 90% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:29.201 aoe m arcane_orb Fluffy_Pillow 60926.0/63371: 96% mana arcane_power, rune_of_power
4:30.510 aoe o arcane_barrage Fluffy_Pillow 62335.1/63371: 98% mana arcane_charge(4), arcane_power, rune_of_power
4:31.913 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
4:33.219 aoe n arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, clearcasting
4:34.526 aoe n arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(2)
4:35.832 aoe n arcane_explosion Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(3)
4:37.139 aoe l rune_of_power Fluffy_Pillow 54995.0/63371: 87% mana arcane_charge(4)
4:38.445 aoe o arcane_barrage Fluffy_Pillow 56650.3/63371: 89% mana arcane_charge(4), rune_of_power
4:39.751 aoe n arcane_explosion Fluffy_Pillow 60840.4/63371: 96% mana rune_of_power
4:41.057 aoe n arcane_explosion Fluffy_Pillow 57495.7/63371: 91% mana arcane_charge, rune_of_power
4:42.362 aoe n arcane_explosion Fluffy_Pillow 54149.6/63371: 85% mana arcane_charge(2), rune_of_power
4:43.668 aoe n arcane_explosion Fluffy_Pillow 50804.9/63371: 80% mana arcane_charge(3), rune_of_power
4:44.974 aoe o arcane_barrage Fluffy_Pillow 47460.2/63371: 75% mana arcane_charge(4), clearcasting, rune_of_power
4:46.280 aoe n arcane_explosion Fluffy_Pillow 51650.3/63371: 82% mana clearcasting, rune_of_power
4:47.587 aoe n arcane_explosion Fluffy_Pillow 53306.8/63371: 84% mana arcane_charge, rune_of_power
4:48.895 aoe n arcane_explosion Fluffy_Pillow 49964.6/63371: 79% mana arcane_charge(2), clearcasting, rune_of_power
4:50.201 aoe n arcane_explosion Fluffy_Pillow 51619.9/63371: 81% mana arcane_charge(3), rune_of_power
4:51.508 aoe o arcane_barrage Fluffy_Pillow 48276.4/63371: 76% mana arcane_charge(4), clearcasting, rune_of_power
4:52.815 aoe m arcane_orb Fluffy_Pillow 52467.8/63371: 83% mana clearcasting, rune_of_power
4:54.121 aoe o arcane_barrage Fluffy_Pillow 53623.1/63371: 85% mana arcane_charge(4), clearcasting
4:55.427 aoe n arcane_explosion Fluffy_Pillow 57813.2/63371: 91% mana clearcasting
4:56.734 aoe n arcane_explosion Fluffy_Pillow 59469.7/63371: 94% mana arcane_charge
4:58.040 aoe n arcane_explosion Fluffy_Pillow 56125.0/63371: 89% mana arcane_charge(2)
4:59.346 aoe n arcane_explosion Fluffy_Pillow 52780.2/63371: 83% mana arcane_charge(3)
5:00.652 aoe o arcane_barrage Fluffy_Pillow 49435.5/63371: 78% mana arcane_charge(4)
5:01.957 aoe n arcane_explosion Fluffy_Pillow 53624.3/63371: 85% mana
5:03.263 aoe n arcane_explosion Fluffy_Pillow 50279.6/63371: 79% mana arcane_charge
5:04.568 aoe n arcane_explosion Fluffy_Pillow 46933.6/63371: 74% mana arcane_charge(2)
5:05.875 aoe n arcane_explosion Fluffy_Pillow 43590.1/63371: 69% mana arcane_charge(3), clearcasting
5:07.182 aoe o arcane_barrage Fluffy_Pillow 45246.7/63371: 71% mana arcane_charge(4)
5:08.490 aoe n arcane_explosion Fluffy_Pillow 49439.3/63371: 78% mana
5:09.798 aoe n arcane_explosion Fluffy_Pillow 46097.1/63371: 73% mana arcane_charge
5:11.103 aoe n arcane_explosion Fluffy_Pillow 42751.1/63371: 67% mana arcane_charge(2)
5:12.411 aoe n arcane_explosion Fluffy_Pillow 39408.9/63371: 62% mana arcane_charge(3), clearcasting
5:13.717 aoe o arcane_barrage Fluffy_Pillow 41064.2/63371: 65% mana arcane_charge(4)
5:15.022 aoe m arcane_orb Fluffy_Pillow 45253.0/63371: 71% mana
5:16.330 aoe o arcane_barrage Fluffy_Pillow 46410.8/63371: 73% mana arcane_charge(4)
5:17.637 aoe n arcane_explosion Fluffy_Pillow 50602.2/63371: 80% mana
5:18.943 aoe n arcane_explosion Fluffy_Pillow 47257.5/63371: 75% mana arcane_charge
5:20.248 aoe n arcane_explosion Fluffy_Pillow 43911.4/63371: 69% mana arcane_charge(2), clearcasting
5:21.556 aoe n arcane_explosion Fluffy_Pillow 45569.2/63371: 72% mana arcane_charge(3)
5:22.863 aoe o arcane_barrage Fluffy_Pillow 42225.8/63371: 67% mana arcane_charge(4)
5:24.170 aoe j touch_of_the_magi Fluffy_Pillow 46417.2/63371: 73% mana
5:25.476 aoe l rune_of_power Fluffy_Pillow 45572.4/63371: 72% mana arcane_charge(4)
5:26.781 aoe o arcane_barrage Fluffy_Pillow 47226.4/63371: 75% mana arcane_charge(4), rune_of_power
5:28.087 aoe n arcane_explosion Fluffy_Pillow 51416.5/63371: 81% mana rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="arcane"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Simulation & Raid Information

Iterations: 1135
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.7 )

Performance:

Total Events Processed: 20765396
Max Event Queue: 268
Sim Seconds: 341336
CPU Seconds: 43.1562
Physical Seconds: 4.6760
Speed Up: 7909

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Forgelite Kyrian_Forgelite arcane_barrage 44425 1194311 3971 33.17 6035 11983 55.5 166.3 19.3% 0.0% 0.0% 0.0% 5.42sec 1194311 300.74sec
Kyrian_Forgelite Kyrian_Forgelite arcane_echo 342232 111703 371 35.41 527 1054 59.2 177.5 19.4% 0.0% 0.0% 0.0% 4.67sec 111703 300.74sec
Kyrian_Forgelite Kyrian_Forgelite arcane_explosion 1449 1391048 4625 89.27 2604 5218 149.2 447.5 19.3% 0.0% 0.0% 0.0% 1.98sec 1391048 300.74sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb 153626 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.18sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb_bolt 153640 252993 841 7.66 5526 11079 38.4 38.4 19.2% 0.0% 0.0% 0.0% 24.18sec 252993 300.74sec
Kyrian_Forgelite Kyrian_Forgelite arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 132.14sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 263.81sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.74sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite deathly_eruption 322256 20330 68 2.93 1164 2327 14.7 14.7 19.1% 0.0% 0.0% 0.0% 1.74sec 20330 300.74sec
Kyrian_Forgelite Kyrian_Forgelite evocation 12051 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 166.91sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite frostbolt 116 1800 6 0.20 1481 2961 0.0 1.0 21.5% 0.0% 0.0% 0.0% 0.00sec 1800 300.74sec
Kyrian_Forgelite Kyrian_Forgelite mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite_mirror_image frostbolt 59638 6094 152 135.00 57 114 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6094 40.00sec
Kyrian_Forgelite Kyrian_Forgelite potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark 307443 33764 112 1.85 3039 6105 9.3 9.3 19.8% 0.0% 0.0% 0.0% 33.70sec 56742 300.74sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark ticks -307443 22979 77 12.07 320 638 9.3 60.4 19.2% 0.0% 0.0% 0.0% 33.70sec 56742 300.74sec
Kyrian_Forgelite Kyrian_Forgelite rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 52.86sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi 321507 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 54.24sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi_explosion 210833 272352 906 3.53 15387 0 5.9 17.7 0.0% 0.0% 0.0% 0.0% 54.11sec 272352 300.74sec
Kyrian_Forgelite Kyrian_Forgelite use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.69sec 0 300.74sec
Kyrian_Forgelite Kyrian_Forgelite_bron anima_cannon 332525 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 22.08sec 0 62.55sec
Kyrian_Forgelite Kyrian_Forgelite_bron goliath_support 332526 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 11.95sec 0 62.55sec
Kyrian_Forgelite Kyrian_Forgelite_bron melee 0 4537 73 18.08 202 404 18.8 18.8 19.0% 0.0% 0.0% 0.0% 9.07sec 6480 62.55sec
Kyrian_Forgelite Kyrian_Forgelite_bron smash 341163 0 0 0.00 0 0 8.2 0.0 0.0% 0.0% 0.0% 0.0% 21.91sec 0 62.55sec
Kyrian_Pelagos Kyrian_Pelagos arcane_barrage 44425 1206670 4012 33.20 6087 12123 55.5 166.4 19.3% 0.0% 0.0% 0.0% 5.41sec 1206670 300.74sec
Kyrian_Pelagos Kyrian_Pelagos arcane_echo 342232 112211 373 35.53 527 1057 59.4 178.1 19.4% 0.0% 0.0% 0.0% 4.70sec 112211 300.74sec
Kyrian_Pelagos Kyrian_Pelagos arcane_explosion 1449 1409936 4688 89.34 2639 5279 149.3 447.8 19.3% 0.0% 0.0% 0.0% 1.98sec 1409936 300.74sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb 153626 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.12sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb_bolt 153640 258766 860 7.65 5657 11336 38.4 38.4 19.2% 0.0% 0.0% 0.0% 24.12sec 258766 300.74sec
Kyrian_Pelagos Kyrian_Pelagos arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 132.28sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 264.16sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.79sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos deathly_eruption 322256 20409 68 2.93 1164 2327 14.7 14.7 19.3% 0.0% 0.0% 0.0% 1.79sec 20409 300.74sec
Kyrian_Pelagos Kyrian_Pelagos evocation 12051 0 0 0.00 0 0 0.9 0.0 0.0% 0.0% 0.0% 0.0% 178.11sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos frostbolt 116 1757 6 0.20 1481 2961 0.0 1.0 18.7% 0.0% 0.0% 0.0% 0.00sec 1757 300.74sec
Kyrian_Pelagos Kyrian_Pelagos mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos_mirror_image frostbolt 59638 6111 153 135.00 57 114 90.0 90.0 19.5% 0.0% 0.0% 0.0% 1.29sec 6111 40.00sec
Kyrian_Pelagos Kyrian_Pelagos potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark 307443 33616 112 1.85 3032 6061 9.3 9.3 19.3% 0.0% 0.0% 0.0% 33.83sec 56671 300.74sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark ticks -307443 23055 77 12.10 320 640 9.3 60.5 19.0% 0.0% 0.0% 0.0% 33.83sec 56671 300.74sec
Kyrian_Pelagos Kyrian_Pelagos rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 52.71sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi 321507 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 54.14sec 0 300.74sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi_explosion 210833 281832 937 3.55 15860 0 5.9 17.8 0.0% 0.0% 0.0% 0.0% 54.02sec 281832 300.74sec
Kyrian_Pelagos Kyrian_Pelagos use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.63sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni arcane_barrage 44425 970926 3228 29.69 5464 10972 49.7 148.8 19.2% 0.0% 0.0% 0.0% 5.66sec 970926 300.74sec
Necrolord_Emeni Necrolord_Emeni arcane_blast 30451 932969 3102 17.09 9132 18286 29.6 85.7 19.2% 0.0% 0.0% 0.0% 8.56sec 932969 300.74sec
Necrolord_Emeni Necrolord_Emeni arcane_echo 342232 80370 267 22.63 594 1187 37.8 113.4 19.4% 0.0% 0.0% 0.0% 7.39sec 80370 300.74sec
Necrolord_Emeni Necrolord_Emeni arcane_explosion 1449 1107625 3683 77.43 2391 4782 129.4 388.1 19.3% 0.0% 0.0% 0.0% 2.12sec 1107625 300.74sec
Necrolord_Emeni Necrolord_Emeni arcane_orb 153626 0 0 0.00 0 0 11.5 0.0 0.0% 0.0% 0.0% 0.0% 25.05sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni arcane_orb_bolt 153640 211000 702 6.89 5120 10219 34.5 34.5 19.4% 0.0% 0.0% 0.0% 25.02sec 211000 300.74sec
Necrolord_Emeni Necrolord_Emeni arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.42sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.81sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni deathborne 324220 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.89sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni deathly_fixation 322253 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 1.83sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni deathly_eruption 322256 18821 63 2.71 1164 2327 13.6 13.6 19.2% 0.0% 0.0% 0.0% 1.83sec 18821 300.74sec
Necrolord_Emeni Necrolord_Emeni evocation 12051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 168.23sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni frostbolt 116 1729 6 0.20 1481 2961 0.0 1.0 16.8% 0.0% 0.0% 0.0% 0.00sec 1729 300.74sec
Necrolord_Emeni Necrolord_Emeni mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni_mirror_image frostbolt 59638 6795 170 135.00 63 127 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6795 40.00sec
Necrolord_Emeni Necrolord_Emeni potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni presence_of_mind 205025 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.70sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 51.15sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.36sec 0 300.74sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi_explosion 210833 294925 981 3.65 16119 0 6.1 18.3 0.0% 0.0% 0.0% 0.0% 52.25sec 294925 300.74sec
Necrolord_Emeni Necrolord_Emeni use_mana_gem 5405 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.74sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth arcane_barrage 44425 953034 3169 29.70 5359 10729 49.7 148.9 19.4% 0.0% 0.0% 0.0% 5.65sec 953034 300.74sec
Necrolord_Marileth Necrolord_Marileth arcane_blast 30451 814799 2709 17.12 7953 15905 29.7 85.8 19.4% 0.0% 0.0% 0.0% 8.38sec 814799 300.74sec
Necrolord_Marileth Necrolord_Marileth arcane_echo 342232 74658 248 22.61 552 1105 37.8 113.3 19.3% 0.0% 0.0% 0.0% 7.38sec 74658 300.74sec
Necrolord_Marileth Necrolord_Marileth arcane_explosion 1449 1095471 3643 77.43 2365 4725 129.4 388.1 19.4% 0.0% 0.0% 0.0% 2.12sec 1095471 300.74sec
Necrolord_Marileth Necrolord_Marileth arcane_orb 153626 0 0 0.00 0 0 11.5 0.0 0.0% 0.0% 0.0% 0.0% 24.94sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth arcane_orb_bolt 153640 205939 685 6.90 5004 10013 34.6 34.6 19.0% 0.0% 0.0% 0.0% 24.95sec 205939 300.74sec
Necrolord_Marileth Necrolord_Marileth arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.34sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.63sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth deathborne 324220 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.76sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth deathly_fixation 322253 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth deathly_eruption 322256 18936 63 2.71 1164 2327 13.6 13.6 19.7% 0.0% 0.0% 0.0% 1.78sec 18936 300.74sec
Necrolord_Marileth Necrolord_Marileth evocation 12051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 175.89sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth frostbolt 116 1765 6 0.20 1481 2961 0.0 1.0 19.2% 0.0% 0.0% 0.0% 0.00sec 1765 300.74sec
Necrolord_Marileth Necrolord_Marileth mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth_mirror_image frostbolt 59638 6033 151 135.00 56 112 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6033 40.00sec
Necrolord_Marileth Necrolord_Marileth potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth presence_of_mind 205025 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.44sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 51.06sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.37sec 0 300.74sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi_explosion 210833 271128 902 3.65 14824 0 6.1 18.3 0.0% 0.0% 0.0% 0.0% 52.26sec 271128 300.74sec
Necrolord_Marileth Necrolord_Marileth use_mana_gem 5405 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.84sec 0 300.74sec
NightFae_Dream NightFae_Dream arcane_barrage 44425 1210631 4026 32.49 6247 12433 54.4 162.8 19.2% 0.0% 0.0% 0.0% 5.55sec 1210631 300.74sec
NightFae_Dream NightFae_Dream arcane_echo 342232 86892 289 24.80 586 1172 41.4 124.3 19.3% 0.0% 0.0% 0.0% 6.90sec 86892 300.74sec
NightFae_Dream NightFae_Dream arcane_explosion 1449 1399564 4654 85.54 2736 5473 142.9 428.7 19.3% 0.0% 0.0% 0.0% 2.08sec 1399564 300.74sec
NightFae_Dream NightFae_Dream arcane_orb 153626 0 0 0.00 0 0 13.9 0.0 0.0% 0.0% 0.0% 0.0% 22.30sec 0 300.74sec
NightFae_Dream NightFae_Dream arcane_orb_bolt 153640 265212 882 8.30 5337 10681 41.6 41.6 19.4% 0.0% 0.0% 0.0% 22.30sec 265212 300.74sec
NightFae_Dream NightFae_Dream arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.26sec 0 300.74sec
NightFae_Dream NightFae_Dream berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.82sec 0 300.74sec
NightFae_Dream NightFae_Dream conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Dream NightFae_Dream deathly_fixation 322253 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 9.00sec 0 300.74sec
NightFae_Dream NightFae_Dream deathly_eruption 322256 25935 86 3.72 1164 2327 18.6 18.6 19.5% 0.0% 0.0% 0.0% 9.00sec 25935 300.74sec
NightFae_Dream NightFae_Dream evocation 12051 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Dream NightFae_Dream flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Dream NightFae_Dream food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Dream NightFae_Dream frostbolt 116 1768 6 0.20 1481 2961 0.0 1.0 19.4% 0.0% 0.0% 0.0% 0.00sec 1768 300.74sec
NightFae_Dream NightFae_Dream mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Dream NightFae_Dream_mirror_image frostbolt 59638 6038 151 135.00 56 112 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6038 40.00sec
NightFae_Dream NightFae_Dream potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.46sec 0 300.74sec
NightFae_Dream NightFae_Dream rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 48.01sec 0 300.74sec
NightFae_Dream NightFae_Dream shifting_power ticks -314791 116185 387 4.73 1372 2745 6.0 23.6 19.4% 0.0% 0.0% 0.0% 49.54sec 116185 300.74sec
NightFae_Dream NightFae_Dream touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.18sec 0 300.74sec
NightFae_Dream NightFae_Dream touch_of_the_magi_explosion 210833 251662 837 3.92 12820 0 6.6 19.6 0.0% 0.0% 0.0% 0.0% 49.07sec 251662 300.74sec
NightFae_Dream NightFae_Dream use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.54sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB arcane_barrage 44425 1227963 4083 32.50 6324 12633 54.4 162.9 19.3% 0.0% 0.0% 0.0% 5.54sec 1227963 300.74sec
NightFae_Dream_SB NightFae_Dream_SB arcane_echo 342232 88004 293 24.82 593 1188 41.5 124.4 19.2% 0.0% 0.0% 0.0% 6.89sec 88004 300.74sec
NightFae_Dream_SB NightFae_Dream_SB arcane_explosion 1449 1417624 4714 85.54 2772 5543 142.9 428.7 19.3% 0.0% 0.0% 0.0% 2.08sec 1417624 300.74sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb 153626 0 0 0.00 0 0 13.9 0.0 0.0% 0.0% 0.0% 0.0% 22.25sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb_bolt 153640 269166 895 8.31 5413 10863 41.6 41.6 19.3% 0.0% 0.0% 0.0% 22.25sec 269166 300.74sec
NightFae_Dream_SB NightFae_Dream_SB arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.20sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.64sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB deathly_fixation 322253 0 0 0.00 0 0 18.7 0.0 0.0% 0.0% 0.0% 0.0% 9.17sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB deathly_eruption 322256 26313 87 3.72 1181 2362 18.7 18.7 19.3% 0.0% 0.0% 0.0% 9.17sec 26313 300.74sec
NightFae_Dream_SB NightFae_Dream_SB evocation 12051 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB frostbolt 116 1811 6 0.20 1520 3040 0.0 1.0 19.1% 0.0% 0.0% 0.0% 0.00sec 1811 300.74sec
NightFae_Dream_SB NightFae_Dream_SB mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB_mirror_image frostbolt 59638 6112 153 135.00 57 114 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6112 40.00sec
NightFae_Dream_SB NightFae_Dream_SB potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.52sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 47.97sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB shifting_power ticks -314791 117924 393 4.73 1394 2789 6.0 23.7 19.2% 0.0% 0.0% 0.0% 49.49sec 117924 300.74sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.15sec 0 300.74sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi_explosion 210833 255264 849 3.92 13006 0 6.6 19.7 0.0% 0.0% 0.0% 0.0% 49.05sec 255264 300.74sec
NightFae_Dream_SB NightFae_Dream_SB use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.74sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon arcane_barrage 44425 1237386 4115 32.48 6361 12809 54.3 162.8 19.3% 0.0% 0.0% 0.0% 5.55sec 1237386 300.74sec
NightFae_Koraylon NightFae_Koraylon arcane_echo 342232 89814 299 24.79 606 1212 41.4 124.3 19.3% 0.0% 0.0% 0.0% 6.89sec 89814 300.74sec
NightFae_Koraylon NightFae_Koraylon arcane_explosion 1449 1441556 4793 85.52 2820 5641 142.9 428.7 19.2% 0.0% 0.0% 0.0% 2.08sec 1441556 300.74sec
NightFae_Koraylon NightFae_Koraylon arcane_orb 153626 0 0 0.00 0 0 13.9 0.0 0.0% 0.0% 0.0% 0.0% 22.31sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon arcane_orb_bolt 153640 273157 908 8.30 5493 11056 41.6 41.6 19.3% 0.0% 0.0% 0.0% 22.32sec 273157 300.74sec
NightFae_Koraylon NightFae_Koraylon arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.24sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.78sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon deathly_fixation 322253 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 9.14sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon deathly_eruption 322256 27782 92 3.72 1253 2507 18.6 18.6 18.9% 0.0% 0.0% 0.0% 9.14sec 27782 300.74sec
NightFae_Koraylon NightFae_Koraylon evocation 12051 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon frostbolt 116 1921 6 0.20 1629 3257 0.0 1.0 18.0% 0.0% 0.0% 0.0% 0.00sec 1921 300.74sec
NightFae_Koraylon NightFae_Koraylon mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon_mirror_image frostbolt 59638 6038 151 135.00 56 112 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6038 40.00sec
NightFae_Koraylon NightFae_Koraylon potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.47sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 48.00sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon shifting_power ticks -314791 118705 396 4.73 1402 2806 6.0 23.6 19.3% 0.0% 0.0% 0.0% 49.53sec 118705 300.74sec
NightFae_Koraylon NightFae_Koraylon touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.18sec 0 300.74sec
NightFae_Koraylon NightFae_Koraylon touch_of_the_magi_explosion 210833 259391 863 3.92 13226 0 6.6 19.6 0.0% 0.0% 0.0% 0.0% 49.08sec 259391 300.74sec
NightFae_Koraylon NightFae_Koraylon use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.64sec 0 300.74sec
NightFae_Niya NightFae_Niya arcane_barrage 44425 1234831 4106 32.57 6336 12675 54.5 163.2 19.4% 0.0% 0.0% 0.0% 5.54sec 1234831 300.74sec
NightFae_Niya NightFae_Niya arcane_echo 342232 87027 289 24.82 586 1171 41.5 124.4 19.4% 0.0% 0.0% 0.0% 6.89sec 87027 300.74sec
NightFae_Niya NightFae_Niya arcane_explosion 1449 1435183 4772 85.76 2798 5595 143.3 429.9 19.3% 0.0% 0.0% 0.0% 2.07sec 1435183 300.74sec
NightFae_Niya NightFae_Niya arcane_orb 153626 0 0 0.00 0 0 14.0 0.0 0.0% 0.0% 0.0% 0.0% 22.19sec 0 300.74sec
NightFae_Niya NightFae_Niya arcane_orb_bolt 153640 270621 900 8.34 5439 10863 41.8 41.8 19.1% 0.0% 0.0% 0.0% 22.19sec 270621 300.74sec
NightFae_Niya NightFae_Niya arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.17sec 0 300.74sec
NightFae_Niya NightFae_Niya berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.72sec 0 300.74sec
NightFae_Niya NightFae_Niya conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Niya NightFae_Niya deathly_fixation 322253 0 0 0.00 0 0 18.9 0.0 0.0% 0.0% 0.0% 0.0% 8.88sec 0 300.74sec
NightFae_Niya NightFae_Niya deathly_eruption 322256 26148 87 3.77 1164 2327 18.9 18.9 19.0% 0.0% 0.0% 0.0% 8.88sec 26148 300.74sec
NightFae_Niya NightFae_Niya evocation 12051 0 0 0.00 0 0 0.1 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Niya NightFae_Niya flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Niya NightFae_Niya food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Niya NightFae_Niya frostbolt 116 1760 6 0.20 1481 2961 0.0 1.0 18.9% 0.0% 0.0% 0.0% 0.00sec 1760 300.74sec
NightFae_Niya NightFae_Niya mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
NightFae_Niya NightFae_Niya_mirror_image frostbolt 59638 6043 151 135.00 56 112 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 6043 40.00sec
NightFae_Niya NightFae_Niya potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.44sec 0 300.74sec
NightFae_Niya NightFae_Niya rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 48.00sec 0 300.74sec
NightFae_Niya NightFae_Niya shifting_power ticks -314791 116016 387 4.73 1372 2745 6.0 23.6 19.2% 0.0% 0.0% 0.0% 49.52sec 116016 300.74sec
NightFae_Niya NightFae_Niya touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.12sec 0 300.74sec
NightFae_Niya NightFae_Niya touch_of_the_magi_explosion 210833 257040 855 3.92 13093 0 6.6 19.7 0.0% 0.0% 0.0% 0.0% 49.01sec 257040 300.74sec
NightFae_Niya NightFae_Niya use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.56sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia arcane_barrage 44425 1223242 4067 34.51 5930 11865 57.7 173.0 19.3% 0.0% 0.0% 0.0% 5.20sec 1223242 300.74sec
Venthyr_Nadjia Venthyr_Nadjia arcane_blast 30451 1 0 0.00 1324 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 1 300.74sec
Venthyr_Nadjia Venthyr_Nadjia arcane_echo 342232 83044 276 25.96 534 1071 43.4 130.1 19.4% 0.0% 0.0% 0.0% 6.40sec 83044 300.74sec
Venthyr_Nadjia Venthyr_Nadjia arcane_explosion 1449 1440009 4788 94.03 2564 5110 157.1 471.3 19.3% 0.0% 0.0% 0.0% 1.88sec 1440009 300.74sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.41sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb_bolt 153640 255761 850 7.90 5434 10826 39.6 39.6 19.1% 0.0% 0.0% 0.0% 23.41sec 255761 300.74sec
Venthyr_Nadjia Venthyr_Nadjia arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.17sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 254.27sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia deathly_fixation 322253 0 0 0.00 0 0 14.8 0.0 0.0% 0.0% 0.0% 0.0% 1.76sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia deathly_eruption 322256 20544 68 2.95 1164 2327 14.8 14.8 19.3% 0.0% 0.0% 0.0% 1.76sec 20544 300.74sec
Venthyr_Nadjia Venthyr_Nadjia evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 160.07sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia frostbolt 116 1763 6 0.20 1481 2961 0.0 1.0 19.0% 0.0% 0.0% 0.0% 0.00sec 1763 300.74sec
Venthyr_Nadjia Venthyr_Nadjia mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia_mirror_image frostbolt 59638 6105 153 135.00 57 114 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 6105 40.00sec
Venthyr_Nadjia Venthyr_Nadjia mirrors_of_torment 314793 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 128.43sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia agonizing_backlash 320035 20916 70 1.13 3098 6205 5.7 5.7 19.0% 0.0% 0.0% 0.0% 52.55sec 20916 300.74sec
Venthyr_Nadjia Venthyr_Nadjia tormenting_backlash 317589 26514 88 0.55 8104 15980 2.8 2.8 18.7% 0.0% 0.0% 0.0% 130.29sec 26514 300.74sec
Venthyr_Nadjia Venthyr_Nadjia potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.68sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.73sec 0 300.74sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi_explosion 210833 236392 786 3.68 12820 0 6.2 18.4 0.0% 0.0% 0.0% 0.0% 51.64sec 236392 300.74sec
Venthyr_Nadjia Venthyr_Nadjia use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 124.10sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar arcane_barrage 44425 1216248 4044 34.14 5953 11961 57.1 171.1 19.2% 0.0% 0.0% 0.0% 5.26sec 1216248 300.74sec
Venthyr_Theotar Venthyr_Theotar arcane_echo 342232 81415 271 25.60 533 1064 42.8 128.3 19.2% 0.0% 0.0% 0.0% 6.56sec 81415 300.74sec
Venthyr_Theotar Venthyr_Theotar arcane_explosion 1449 1442572 4797 92.22 2619 5229 154.1 462.2 19.3% 0.0% 0.0% 0.0% 1.92sec 1442572 300.74sec
Venthyr_Theotar Venthyr_Theotar arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.50sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar arcane_orb_bolt 153640 259474 863 7.86 5524 11037 39.4 39.4 19.3% 0.0% 0.0% 0.0% 23.49sec 259474 300.74sec
Venthyr_Theotar Venthyr_Theotar arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.27sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.50sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar deathly_eruption 322256 20451 68 2.93 1164 2327 14.7 14.7 19.6% 0.0% 0.0% 0.0% 1.78sec 20451 300.74sec
Venthyr_Theotar Venthyr_Theotar evocation 12051 0 0 0.00 0 0 0.8 0.0 0.0% 0.0% 0.0% 0.0% 170.27sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar frostbolt 116 1776 6 0.20 1481 2961 0.0 1.0 19.9% 0.0% 0.0% 0.0% 0.00sec 1776 300.74sec
Venthyr_Theotar Venthyr_Theotar mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar_mirror_image frostbolt 59638 6095 152 135.00 57 114 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6095 40.00sec
Venthyr_Theotar Venthyr_Theotar mirrors_of_torment 314793 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 137.68sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar agonizing_backlash 320035 19357 64 1.06 3040 6072 5.3 5.3 20.0% 0.0% 0.0% 0.0% 55.09sec 19357 300.74sec
Venthyr_Theotar Venthyr_Theotar tormenting_backlash 317589 24590 82 0.51 7993 15980 2.6 2.6 19.7% 0.0% 0.0% 0.0% 138.69sec 24590 300.74sec
Venthyr_Theotar Venthyr_Theotar potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar rune_of_power 116011 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 51.60sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.91sec 0 300.74sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi_explosion 210833 242884 808 3.62 13400 0 6.1 18.1 0.0% 0.0% 0.0% 0.0% 52.81sec 242884 300.74sec
Venthyr_Theotar Venthyr_Theotar use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 124.26sec 0 300.74sec
arcane arcane arcane_barrage 44425 1209430 4022 34.29 5908 11790 57.4 171.9 19.2% 0.0% 0.0% 0.0% 5.25sec 1209430 300.74sec
arcane arcane arcane_echo 342232 70094 233 22.03 532 1062 36.8 110.4 19.4% 0.0% 0.0% 0.0% 7.63sec 70094 300.74sec
arcane arcane arcane_explosion 1449 1424748 4738 92.90 2565 5136 155.2 465.6 19.3% 0.0% 0.0% 0.0% 1.91sec 1424748 300.74sec
arcane arcane arcane_orb 153626 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.65sec 0 300.74sec
arcane arcane arcane_orb_bolt 153640 255151 848 7.85 5461 10904 39.3 39.3 18.8% 0.0% 0.0% 0.0% 23.65sec 255151 300.74sec
arcane arcane arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.38sec 0 300.74sec
arcane arcane berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 256.69sec 0 300.74sec
arcane arcane conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
arcane arcane deathly_fixation 322253 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 1.79sec 0 300.74sec
arcane arcane deathly_eruption 322256 20135 67 2.89 1164 2327 14.5 14.5 19.4% 0.0% 0.0% 0.0% 1.79sec 20135 300.74sec
arcane arcane evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 169.28sec 0 300.74sec
arcane arcane flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
arcane arcane food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
arcane arcane frostbolt 116 1778 6 0.20 1481 2961 0.0 1.0 20.1% 0.0% 0.0% 0.0% 0.00sec 1778 300.74sec
arcane arcane mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
arcane arcane_mirror_image frostbolt 59638 6051 151 135.00 56 113 90.0 90.0 19.6% 0.0% 0.0% 0.0% 1.29sec 6051 40.00sec
arcane arcane potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.74sec
arcane arcane rune_of_power 116011 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 51.14sec 0 300.74sec
arcane arcane touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.22sec 0 300.74sec
arcane arcane touch_of_the_magi_explosion 210833 155858 518 3.66 8490 0 6.1 18.4 0.0% 0.0% 0.0% 0.0% 52.13sec 155858 300.74sec
arcane arcane use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.68sec 0 300.74sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
50511.9 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 37.0sec 8.29% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 108.3s

Stack Uptimes

  • Health Decade (0 - 10)_1:8.35%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 21.8sec 6.29% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.7s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.31%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 23.9sec 7.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 35.4s

Stack Uptimes

  • Health Decade (20 - 30)_1:7.78%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 30.3sec 10.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.6s / 40.7s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.13%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.9sec 11.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.7s / 47.0s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.60%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 39.0sec 13.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.7s / 54.3s

Stack Uptimes

  • Health Decade (50 - 60)_1:13.07%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 40.5sec 13.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:34.0s / 48.9s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.65%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 45.8sec 15.41% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:31.8s / 54.8s

Stack Uptimes

  • Health Decade (70 - 80)_1:15.41%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 28.9sec 9.73% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.9s / 47.5s

Stack Uptimes

  • Health Decade (80 - 90)_1:9.73%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 16.1sec 4.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.04%
Mirrors of Torment 2.7 0.0 137.3sec 138.5sec 13.2sec 11.82% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 165.8s
  • trigger_min/max:97.1s / 165.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.19%
  • mirrors_of_torment_2:5.29%
  • mirrors_of_torment_3:1.34%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Mirrors of Torment 2.9 0.0 128.3sec 129.3sec 13.2sec 12.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 162.6s
  • trigger_min/max:93.8s / 162.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.56%
  • mirrors_of_torment_2:5.67%
  • mirrors_of_torment_3:1.43%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Radiant Spark Vulnerability 9.4 27.6 33.3sec 7.9sec 4.8sec 14.82% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 56.6s
  • trigger_min/max:0.5s / 52.7s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.82%
  • radiant_spark_vulnerability_2:3.74%
  • radiant_spark_vulnerability_3:3.53%
  • radiant_spark_vulnerability_4:3.73%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Radiant Spark Vulnerability 9.3 27.5 33.4sec 7.9sec 4.8sec 14.82% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 56.6s
  • trigger_min/max:0.5s / 52.7s
  • trigger_pct:99.99%
  • duration_min/max:0.3s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.83%
  • radiant_spark_vulnerability_2:3.74%
  • radiant_spark_vulnerability_3:3.52%
  • radiant_spark_vulnerability_4:3.74%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Touch of the Magi 6.1 0.0 52.3sec 52.4sec 7.9sec 16.18% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 73.9s
  • trigger_min/max:46.3s / 73.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.18%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.0sec 49.1sec 7.9sec 17.24% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 59.0s
  • trigger_min/max:38.9s / 59.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.24%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.0sec 49.1sec 7.9sec 17.24% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 57.9s
  • trigger_min/max:38.9s / 57.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.24%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.0sec 49.1sec 7.9sec 17.23% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 57.9s
  • trigger_min/max:38.8s / 57.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.23%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.0sec 49.1sec 7.9sec 17.23% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 58.0s
  • trigger_min/max:38.9s / 58.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.23%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.9sec 53.0sec 7.9sec 15.98% 0.00% 0.0 (0.0) 5.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 73.6s
  • trigger_min/max:46.3s / 73.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.98%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.8sec 51.9sec 7.9sec 16.27% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 71.6s
  • trigger_min/max:46.3s / 71.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.27%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 5.9 0.0 54.2sec 54.3sec 7.9sec 15.64% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 77.5s
  • trigger_min/max:47.4s / 77.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.64%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 5.9 0.0 54.4sec 54.6sec 7.9sec 15.59% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 76.2s
  • trigger_min/max:47.4s / 76.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.59%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.3sec 52.5sec 7.9sec 16.14% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 72.8s
  • trigger_min/max:46.3s / 72.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.14%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.4sec 52.5sec 7.9sec 16.16% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 72.7s
  • trigger_min/max:46.3s / 72.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.16%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Fluffy_Pillow Damage Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1119
Mean 53380.32
Minimum 51057.84
Maximum 56278.72
Spread ( max - min ) 5220.88
Range [ ( max - min ) / 2 * 100% ] 4.89%
Standard Deviation 963.8008
5th Percentile 51898.74
95th Percentile 54906.84
( 95th Percentile - 5th Percentile ) 3008.10
Mean Distribution
Standard Deviation 28.8119
95.00% Confidence Interval ( 53323.85 - 53436.79 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1253
0.1 Scale Factor Error with Delta=300 7930
0.05 Scale Factor Error with Delta=300 31719
0.01 Scale Factor Error with Delta=300 792973
HPS
Fluffy_Pillow Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 127
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 18248027 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
32596.5 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 44.1sec 9.74% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 120.5s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.80%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.2sec 6.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.9s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.96%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.9sec 8.79% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 37.1s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.80%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 32.6sec 10.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.2s / 42.1s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.91%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.9sec 11.71% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.3s / 45.5s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.71%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.1sec 11.82% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.7s / 51.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.82%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.7sec 12.71% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.4s / 44.3s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.71%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.9sec 14.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.7s / 50.5s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.14%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 27.1sec 9.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:14.4s / 44.5s

Stack Uptimes

  • Health Decade (80 - 90)_1:9.15%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 16.2sec 4.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.7s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.10%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 2011
death count pct 177.18
avg death time 301.12
min death time 240.10
max death time 358.98
dmg taken 10442946.28

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
enemy2 Damage Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1119
Mean 34743.73
Minimum 33621.35
Maximum 35950.22
Spread ( max - min ) 2328.87
Range [ ( max - min ) / 2 * 100% ] 3.35%
Standard Deviation 507.0093
5th Percentile 33946.03
95th Percentile 35522.26
( 95th Percentile - 5th Percentile ) 1576.23
Mean Distribution
Standard Deviation 15.1566
95.00% Confidence Interval ( 34714.03 - 34773.44 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 9
0.1% Error 819
0.1 Scale Factor Error with Delta=300 2195
0.05 Scale Factor Error with Delta=300 8778
0.01 Scale Factor Error with Delta=300 219440
HPS
enemy2 Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 127
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 12469634 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
33469.7 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 43.1sec 9.52% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 123.7s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.56%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.9sec 7.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 38.5s

Stack Uptimes

  • Health Decade (10 - 20)_1:7.06%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 27.6sec 9.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 38.2s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.01%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 33.7sec 11.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.7s / 44.8s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.26%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.9sec 12.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.8s / 47.2s

Stack Uptimes

  • Health Decade (40 - 50)_1:12.01%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 36.4sec 12.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.6s / 51.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.24%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 39.1sec 13.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.1s / 44.6s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.17%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 42.3sec 14.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.4s / 53.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.27%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 22.5sec 7.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:11.4s / 39.9s

Stack Uptimes

  • Health Decade (80 - 90)_1:7.60%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 15.5sec 3.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.5s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.87%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 2011
death count pct 177.18
avg death time 301.12
min death time 240.10
max death time 358.98
dmg taken 10682700.57

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1119
Mean 300.74
Minimum 240.05
Maximum 359.90
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
enemy3 Damage Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1119
Mean 35544.73
Minimum 34353.68
Maximum 36946.24
Spread ( max - min ) 2592.56
Range [ ( max - min ) / 2 * 100% ] 3.65%
Standard Deviation 494.4004
5th Percentile 34759.06
95th Percentile 36313.85
( 95th Percentile - 5th Percentile ) 1554.79
Mean Distribution
Standard Deviation 14.7796
95.00% Confidence Interval ( 35515.76 - 35573.70 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 744
0.1 Scale Factor Error with Delta=300 2087
0.05 Scale Factor Error with Delta=300 8347
0.01 Scale Factor Error with Delta=300 208662
HPS
enemy3 Healing Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1119
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 127
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 11052180 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.